KEGG   Meyerozyma guilliermondii: PGUG_04073Help
Entry
PGUG_04073        CDS       T01150                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGUG_04073
Transcription machinery [BR:pgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PGUG_04073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 460 aa AA seqDB search
MDCVQDVRAFICSTTKLKVNFIMVDRKRKHDADREVTKKVKVEDPDESTPGRDVDESGGD
ENENENQNEHENENENDDDAENESEDEEENERKRITTIDFDGRTYSYKERPSVIEEKEGK
IEFRVVNNDNTKENLIVLTGLKNIFQKQLPKMPREYIARLVYDRSHLSMAVVRKPLTVVG
GITYRPFSKRGFAEIVFCAILSTEQVRGYGAHLMNHLKDYVRATSPVKYFLTYADNYAIG
YFKKQGFTKDITLDKSVWMGYIKDYEGGTLMQCAMLPPILRYLDLAKILLLQKAAIEKKI
NSRSLSHVVRPGLQVFKSKKDVQLDPADIPGLKEAGWLEEMDKLAQKPKRGPHHNFMVTL
LSELMNHPSAWPFAHPVSKEEVGDYYEVIKEPMDLSTMELKLENDKYESFDQFLYDARLI
FNNCRSYNAETTTYYKNATKLEKFLTNKIKESAEYAHYVE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggattgtgtgcaggatgttcgcgcttttatctgcagcaccacaaaactcaaagtcaac
ttcatcatggtggatcgaaagcgcaagcacgacgctgaccgcgaggtgaccaagaaggtc
aaggttgaagatcccgacgagtcgactccgggaagggacgtggacgagtctgggggcgac
gaaaatgaaaatgaaaaccaaaatgaacacgaaaatgaaaacgaaaacgacgacgacgca
gaaaacgaatctgaagacgaagaggaaaacgaacgaaaacggatcaccaccatagatttt
gacggccgtacgtactcgtacaaggagcggccgtcggtcatagaagaaaaagagggaaaa
attgagtttcgtgttgttaataacgacaacaccaaagaaaacttgattgttcttactgga
ttaaagaacattttccaaaaacaattgcccaaaatgccccgggagtatattgcgcggtta
gtttacgatagaagccatttatctatggcggtagtacggaaacctttaactgtggttggt
ggtatcacttatagacctttcagtaaacgagggtttgccgaaattgttttttgtgccatt
ctgtctaccgagcaagtacgaggctacggagcccatttgatgaaccaccttaaagattac
gttcgtgcaacatcgccggtgaaatattttttgacttacgccgataactatgccattgga
tacttcaagaagcagggcttcaccaaggacataactctcgacaagtcggtgtggatggga
tatatcaaggactacgagggtggtactttgatgcagtgcgccatgcttcctcctattctt
cggtatcttgatctggccaaaattcttcttttgcaaaaagcggctattgaaaagaagatc
aactcacgttccctctcacacgttgtgcgaccgggtcttcaagtgttcaagtccaaaaaa
gatgtgcagctcgacccggccgatattcctgggctaaaggaagcaggatggctggaagaa
atggacaaattggcgcagaaaccaaagcgtggaccacaccacaatttcatggtgacattg
ttatcggagctcatgaaccatccgtcagcatggccgtttgcacatcctgttagtaaggaa
gaagtgggcgactactatgaggttataaaagaaccaatggatctttccaccatggaactg
aagttggagaacgacaagtacgaatcgttcgatcaatttttgtatgatgcccgactcata
ttcaacaattgccgatcatataacgccgaaacgaccacatactacaagaacgctaccaag
ttggagaagtttttgaccaacaaaatcaaagagagtgccgaatatgcccactatgtggag
tga

DBGET integrated database retrieval system