KEGG   Meyerozyma guilliermondii: PGUG_04073Help
Entry
PGUG_04073        CDS       T01150                                 

Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGUG_04073
Transcription machinery [BR:pgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PGUG_04073
Chromosome [BR:pgu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PGUG_04073
   HAT complexes
    PCAF complex
     PGUG_04073
    STAGA complex
     PGUG_04073
    TFTC complex
     PGUG_04073
    SAGA complex
     PGUG_04073
    SLIK complex
     PGUG_04073
    ADA-HAT complex
     PGUG_04073
    HAT-A2 complex
     PGUG_04073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 UBA_e1_thiolCys TFIIE-A_C CobT Nop14
Motif
Other DBs
NCBI-GeneID: 5125318
NCBI-ProteinID: XP_001483345
UniProt: A5DLC2
AA seq 460 aa AA seqDB search
MDCVQDVRAFICSTTKLKVNFIMVDRKRKHDADREVTKKVKVEDPDESTPGRDVDESGGD
ENENENQNEHENENENDDDAENESEDEEENERKRITTIDFDGRTYSYKERPSVIEEKEGK
IEFRVVNNDNTKENLIVLTGLKNIFQKQLPKMPREYIARLVYDRSHLSMAVVRKPLTVVG
GITYRPFSKRGFAEIVFCAILSTEQVRGYGAHLMNHLKDYVRATSPVKYFLTYADNYAIG
YFKKQGFTKDITLDKSVWMGYIKDYEGGTLMQCAMLPPILRYLDLAKILLLQKAAIEKKI
NSRSLSHVVRPGLQVFKSKKDVQLDPADIPGLKEAGWLEEMDKLAQKPKRGPHHNFMVTL
LSELMNHPSAWPFAHPVSKEEVGDYYEVIKEPMDLSTMELKLENDKYESFDQFLYDARLI
FNNCRSYNAETTTYYKNATKLEKFLTNKIKESAEYAHYVE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggattgtgtgcaggatgttcgcgcttttatctgcagcaccacaaaactcaaagtcaac
ttcatcatggtggatcgaaagcgcaagcacgacgctgaccgcgaggtgaccaagaaggtc
aaggttgaagatcccgacgagtcgactccgggaagggacgtggacgagtctgggggcgac
gaaaatgaaaatgaaaaccaaaatgaacacgaaaatgaaaacgaaaacgacgacgacgca
gaaaacgaatctgaagacgaagaggaaaacgaacgaaaacggatcaccaccatagatttt
gacggccgtacgtactcgtacaaggagcggccgtcggtcatagaagaaaaagagggaaaa
attgagtttcgtgttgttaataacgacaacaccaaagaaaacttgattgttcttactgga
ttaaagaacattttccaaaaacaattgcccaaaatgccccgggagtatattgcgcggtta
gtttacgatagaagccatttatctatggcggtagtacggaaacctttaactgtggttggt
ggtatcacttatagacctttcagtaaacgagggtttgccgaaattgttttttgtgccatt
ctgtctaccgagcaagtacgaggctacggagcccatttgatgaaccaccttaaagattac
gttcgtgcaacatcgccggtgaaatattttttgacttacgccgataactatgccattgga
tacttcaagaagcagggcttcaccaaggacataactctcgacaagtcggtgtggatggga
tatatcaaggactacgagggtggtactttgatgcagtgcgccatgcttcctcctattctt
cggtatcttgatctggccaaaattcttcttttgcaaaaagcggctattgaaaagaagatc
aactcacgttccctctcacacgttgtgcgaccgggtcttcaagtgttcaagtccaaaaaa
gatgtgcagctcgacccggccgatattcctgggctaaaggaagcaggatggctggaagaa
atggacaaattggcgcagaaaccaaagcgtggaccacaccacaatttcatggtgacattg
ttatcggagctcatgaaccatccgtcagcatggccgtttgcacatcctgttagtaaggaa
gaagtgggcgactactatgaggttataaaagaaccaatggatctttccaccatggaactg
aagttggagaacgacaagtacgaatcgttcgatcaatttttgtatgatgcccgactcata
ttcaacaattgccgatcatataacgccgaaacgaccacatactacaagaacgctaccaag
ttggagaagtttttgaccaacaaaatcaaagagagtgccgaatatgcccactatgtggag
tga

DBGET integrated database retrieval system