KEGG   Meyerozyma guilliermondii: PGUG_04095Help
Entry
PGUG_04095        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pgu  Meyerozyma guilliermondii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PGUG_04095
  Replication and repair
   03420 Nucleotide excision repair
    PGUG_04095
Transcription machinery [BR:pgu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PGUG_04095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MSANQFKATVNEYLEGLPPTIQSQLYEAPATCLSIFRLLTPIAKFFIMLMIFNERPQSVR
DLDKWCRPQSKSLQYDALKRLKSLHLVEEDAGGNFLRLHMTFRKNFRDCLTGNQEATAFG
NLCTEDDGHKVTVAFLDSFALQKWETILHYMVGTELPSKPSPSVLSLLKLGGLMEGPGTD
ARNLKITNSGFQFLLQDMNAQIWTLLLQYLNLTQDLNMDPVDVLNFLFVLGSLELGKSYY
LSGLSDTQVSMLADLRDYGLVYQYSDQSDRFYPTRLATTLTSESASLKTPSMALDQAVDT
SNGLDSGPGQGSIILETNFKLYAYTNSPLEIAILNLFVNLRTRFSNMVSGQITRESIRNA
LYNGITSDQIINFLETHAHPQMRALAKERLDKKVEFDASNNINTAGGGQNSSAQHKLEIL
PPTVVDQIKLWQLELDRIQAFEGYLFKEFASQQEFDVLCNYASDVGVLIWSDRTKMRFFV
TKDGISQVADFANRKLKR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaaccagttcaaggccaccgtcaacgagtatctagaaggattgccgccgacc
atccagtcgcagctctacgaggcacccgcaacatgtctttccatcttcaggttgttgacg
ccaattgcaaagtttttcatcatgctgatgattttcaacgaacggcctcaatcggttcga
gatctcgacaagtggtgccgtccacagtccaagagtcttcagtacgacgcattgaagcgg
ctcaagtcgttgcatttggtggaggaagatgctgggggcaattttcttcgactccatatg
acgtttcgaaagaactttcgagattgcttaacaggaaaccaggaagccacggcgtttgga
aacttgtgtaccgaggacgacggtcacaaggttacggtggcgtttctcgactcgtttgcg
ctgcaaaaatgggaaacaatcttgcattatatggtgggaactgaacttccttccaaacca
tcaccttcggttttgtcgctcctcaagctgggtggactcatggaaggtccaggaactgat
gctcgcaacttgaagattaccaatagtggatttcagttcttgctacaggacatgaatgcc
caaatatggacacttcttcttcagtatctcaacttgacacaagatctaaacatggacccc
gtcgatgtgctcaattttctcttcgttttggggtctctcgagcttgggaaaagctactac
ctctctggtctcagcgacacccaggttagcatgttggcagacttgcgagattacggtcta
gtgtaccagtacagcgaccaatccgatcgattttatcccacgagactcgctaccactctc
acatccgagtctgcatctctcaaaaccccctccatggcgctagaccaggcggtggacaca
tcaaatggacttgactcgggaccaggtcaaggctcaattattcttgaaaccaactttaaa
ctctacgcatacacaaattctccgttggagattgccattttgaacctatttgtcaactta
aggacgagattctccaatatggtttctggacaaatcacccgagaatccattcgcaacgca
ttgtacaacggaatcacctcggaccaaatcatcaattttctcgagacccatgcccatcca
caaatgcgggctctagccaaggaaagactcgacaagaaggtcgagttcgacgcgagcaac
aacatcaacactgcaggcggtggtcagaactcgtcggctcagcataaactcgaaattctt
ccgcccacagtggtggaccaaatcaagctttggcagttggaattggatcggatccaagcg
ttcgagggctatttgttcaaggagtttgcaagccagcaagaattcgatgttttgtgcaat
tatgcttcggatgtgggagtacttatatggtccgacagaaccaaaatgaggttttttgtc
accaaagatggtatatctcaggtggcagactttgccaatagaaagttgaagcggtga

DBGET integrated database retrieval system