KEGG   Meyerozyma guilliermondii: PGUG_04108Help
Entry
PGUG_04108        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pgu  Meyerozyma guilliermondii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:pgu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pgu03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MVANDVDEGSGSTSGAGKKPRQPRTIDDLYRQSSQFRMWSFTHESLNEIKTKTNEKGRKK
ATETFNHALAQFRQTNSTEYEAHASELTVDLLLDLLTLEEETKYINFYCKNIIETANFFR
MPTQVKATAVSFFRKFYLVHSTMEYHPKNIMYTCVFLAAKSENYFISINSFTKALRNTEN
KDILDLEFTVLEALHFTLLVHHAFRPLYGFYLDFQAVLLHPEPRIRGLTNERLASLLDKG
KEWIMEKALLSDIPFLYTPPQVALAAAYAVDKEVCELYLKIKFEDKLTSIKEEKESEEKQ
EIKQEEGVKQETEVKQESTENEPTALDSAPLTLLLLLETVQLCLKDALGLPESTVEENKA
IDRKCYFALRPKKLIEKRIKKLSNG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaatgacgtcgacgagggctctggaagcacttctggcgccggaaagaaacct
agacagccccgtactattgatgatttgtataggcagtcgtcgcaattccgaatgtggtcg
tttacacacgaatcgctcaatgaaatcaaaactaagaccaatgaaaaaggccgaaaaaaa
gccacagaaacgttcaaccacgcccttgcccagttccgccagaccaactctactgagtat
gaagcccacgcttcggaactcacggtggatctgcttctagaccttcttacgctcgaagag
gaaacgaaatacatcaatttttattgcaaaaacatcatcgaaaccgccaattttttccga
atgcctacacaggtgaaggctactgccgtttccttcttcagaaagttctatcttgtgcat
tctaccatggaatatcaccctaaaaatatcatgtatacttgcgtgtttctcgctgccaaa
tcggaaaactactttatctccatcaattcgttcacaaaagcactccgaaatacagaaaac
aaggatatattggatttggagttcacggtgttggaagcgttgcatttcacacttttggtg
caccatgctttccggccgttgtacggattttatctcgatttccaggcggttttgttgcat
ccggaacctcggattcggggccttacaaacgaaagacttgcttctttgttagacaagggc
aaggaatggataatggagaaagcgttgttgtcggatattccgtttttgtacacccctcct
caagttgcgctagctgctgcttatgccgtggataaagaggtatgtgagttgtacttgaaa
atcaagtttgaagacaagctcacgtctatcaaggaggagaaagaaagtgaggagaaacaa
gagataaaacaagaagaaggagtcaaacaagaaactgaagtaaaacaggaatctacagaa
aacgaaccaactgccttagattctgctcctttgacactactgctactcttggaaactgtc
cagctgtgtttaaaagacgcacttggtttacctgaatccaccgttgaagagaacaaggcc
attgaccggaaatgctactttgcgttgcgtcccaaaaagttgatagaaaaacgcataaag
aagttgagtaatggctag

DBGET integrated database retrieval system