KEGG   Meyerozyma guilliermondii: PGUG_04108Help
Entry
PGUG_04108        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pgu  Meyerozyma guilliermondii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PGUG_04108
  Replication and repair
   03420 Nucleotide excision repair
    PGUG_04108
Transcription machinery [BR:pgu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PGUG_04108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MVANDVDEGSGSTSGAGKKPRQPRTIDDLYRQSSQFRMWSFTHESLNEIKTKTNEKGRKK
ATETFNHALAQFRQTNSTEYEAHASELTVDLLLDLLTLEEETKYINFYCKNIIETANFFR
MPTQVKATAVSFFRKFYLVHSTMEYHPKNIMYTCVFLAAKSENYFISINSFTKALRNTEN
KDILDLEFTVLEALHFTLLVHHAFRPLYGFYLDFQAVLLHPEPRIRGLTNERLASLLDKG
KEWIMEKALLSDIPFLYTPPQVALAAAYAVDKEVCELYLKIKFEDKLTSIKEEKESEEKQ
EIKQEEGVKQETEVKQESTENEPTALDSAPLTLLLLLETVQLCLKDALGLPESTVEENKA
IDRKCYFALRPKKLIEKRIKKLSNG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaatgacgtcgacgagggctctggaagcacttctggcgccggaaagaaacct
agacagccccgtactattgatgatttgtataggcagtcgtcgcaattccgaatgtggtcg
tttacacacgaatcgctcaatgaaatcaaaactaagaccaatgaaaaaggccgaaaaaaa
gccacagaaacgttcaaccacgcccttgcccagttccgccagaccaactctactgagtat
gaagcccacgcttcggaactcacggtggatctgcttctagaccttcttacgctcgaagag
gaaacgaaatacatcaatttttattgcaaaaacatcatcgaaaccgccaattttttccga
atgcctacacaggtgaaggctactgccgtttccttcttcagaaagttctatcttgtgcat
tctaccatggaatatcaccctaaaaatatcatgtatacttgcgtgtttctcgctgccaaa
tcggaaaactactttatctccatcaattcgttcacaaaagcactccgaaatacagaaaac
aaggatatattggatttggagttcacggtgttggaagcgttgcatttcacacttttggtg
caccatgctttccggccgttgtacggattttatctcgatttccaggcggttttgttgcat
ccggaacctcggattcggggccttacaaacgaaagacttgcttctttgttagacaagggc
aaggaatggataatggagaaagcgttgttgtcggatattccgtttttgtacacccctcct
caagttgcgctagctgctgcttatgccgtggataaagaggtatgtgagttgtacttgaaa
atcaagtttgaagacaagctcacgtctatcaaggaggagaaagaaagtgaggagaaacaa
gagataaaacaagaagaaggagtcaaacaagaaactgaagtaaaacaggaatctacagaa
aacgaaccaactgccttagattctgctcctttgacactactgctactcttggaaactgtc
cagctgtgtttaaaagacgcacttggtttacctgaatccaccgttgaagagaacaaggcc
attgaccggaaatgctactttgcgttgcgtcccaaaaagttgatagaaaaacgcataaag
aagttgagtaatggctag

DBGET integrated database retrieval system