KEGG   Meyerozyma guilliermondii: PGUG_04154Help
Entry
PGUG_04154        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00480  Glutathione metabolism
pgu00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PGUG_04154
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PGUG_04154
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PGUG_04154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 5125342
NCBI-ProteinID: XP_001483425
UniProt: A5DLK3
AA seq 164 aa AA seqDB search
MAPTAMFYDFTVLDNQKRPLPLSLLKGKVVVVVNVATLCGFAPQYYELQQIWNLHRDKGL
VILAFPCNQFGNQEPLPAAQVAAQVHAEYGVTFPIMEKVYVNGPHEHPLYTFLKNQQKNC
LGFKGIKWNFEKFVIDRNGEVVRRFGTDTPPRAIEPYLRELLEN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcacctaccgcaatgttttatgatttcaccgtccttgataatcaaaaacgacctttg
ccattgtcacttctcaagggcaaggtggtggtggttgtcaatgtagcaactttgtgtggg
tttgctccccaatattacgaattgcaacaaatatggaacctccatcgagataaaggtttg
gtcattttggcatttccttgcaaccaattcggtaaccaagagccgttaccggcagcacag
gtggcggcgcaggtgcacgctgaatacggggtgacgtttcctatcatggaaaaggtttat
gtcaatggtccccatgagcatcctttatacacatttttgaaaaaccagcaaaaaaactgt
ttggggttcaaaggcattaaatggaactttgaaaagtttgtcattgatagaaatggcgag
gtggtacgacggtttggtacggatactccaccaagagccatagagccatatcttcgtgag
cttctcgaaaattga

DBGET integrated database retrieval system