KEGG   Meyerozyma guilliermondii: PGUG_04266Help
Entry
PGUG_04266        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGUG_04266
   00052 Galactose metabolism
    PGUG_04266
   00500 Starch and sucrose metabolism
    PGUG_04266
   00520 Amino sugar and nucleotide sugar metabolism
    PGUG_04266
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PGUG_04266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
MRNALNALVDTVKDPEAQAKFENEMDSFFALFRRYLTDKASGTTLDWDKIKSPSESEVVL
YDSLKSETADNLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEHLNRKY
DSDVPLLLMNSFNTDADTAKIIKKYQGHRIRVRTFNQSRFPRIFKDSLLPVPESFDDELD
GWYPPGHGDLYEALISSGELDSLLAQGREILFVSNGDNLGATVDTKILDHMIETGAEYLM
ELTDKTRADVKGGTLINYDGQVRLLEIAQVPKEHVEDFKSIKIIQVLQHQQLVDQLEGR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatgccttgaatgcattggtcgataccgtcaaggatccagaagcccaagccaag
tttgaaaacgagatggattcatttttcgccttgtttagacggtatttgaccgataaggcg
tcgggaaccactcttgattgggacaaaatcaagtcgccaagtgagagtgaggttgtgctg
tatgactctctcaaatcggaaactgccgacaatttgagcaaattggcagtgctcaagttg
aacggaggattgggtacgtctatgggctgtgtgggtcccaaatcggtcattgaagtaaga
gatggcaacacatttttggatttgtcggtgagacaaatcgagcatcttaatcgtaaatac
gattctgatgttcctctcttgttgatgaactcgtttaacaccgatgccgacaccgccaag
atcatcaagaagtaccagggccacagaatcagagtgagaaccttcaaccaatcgagattt
cctcgtatttttaaggactcgttgttgccggttcccgagtcgtttgacgacgaattggac
ggttggtaccccccaggtcacggagacttgtacgaggcattgatctcatcaggtgaattg
gactcgcttttggcccagggaagagaaattttgtttgtgtccaatggtgataatttagga
gccactgtcgacaccaagattttggaccacatgatcgaaaccggagcagagtatctcatg
gaattgaccgacaaaaccagagccgatgttaagggaggaactttgatcaattatgatggc
caagttcggttgttggaaattgctcaggtacccaaggagcacgttgaagatttcaagtcg
atcaaaataattcaagtacttcaacaccaacaacttgtggatcaacttgaaggccgttaa

DBGET integrated database retrieval system