KEGG   Meyerozyma guilliermondii: PGUG_04431Help
Entry
PGUG_04431        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
pgu  Meyerozyma guilliermondii
Brite
Membrane trafficking [BR:pgu04131]
 Others
  Actin-binding proteins
   Others
    PGUG_04431
Cytoskeleton proteins [BR:pgu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     PGUG_04431
Exosome [BR:pgu04147]
 Exosomal proteins
  Proteins found in most exosomes
   PGUG_04431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQAYTDNLTATGKIDKAALYSRAGDSLWAQSGGFQLEANEIAEIAGAFDDPSSLQTSG
LHLQKQKYFLLRADERSIYGKLQEEGVVAVRTKQAILLAHYPRGVEPGSATTVVEKLADY
LISVNY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcatacacagacaatctcacagctactggcaagattgataaggcagcg
ttatactcgagggcaggagactcgttgtgggcgcaatcgggcggtttccagctcgaggca
aacgaaattgccgagatcgctggtgcttttgatgacccttcttcattacaaacttcgggg
ttgcacctccagaaacaaaagtactttttgttgagggcggacgaacggtcgatttacgga
aaactccaggaagaaggtgtggtggccgtcagaaccaaacaggcgattttgcttgcacat
tatcctcgtggtgtggagcctgggtcggccacgactgtagtagagaagttggcggactac
ttgattagtgttaactattaa

DBGET integrated database retrieval system