KEGG   Meyerozyma guilliermondii: PGUG_04567Help
Entry
PGUG_04567        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PGUG_04567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Spore_IV_A Flavodoxin_5 Fer4_12 Mei5_like
Motif
Other DBs
NCBI-GeneID: 5125676
NCBI-ProteinID: XP_001483838
UniProt: A5DMR6
AA seq 680 aa AA seqDB search
MALDTLDYSVMVGLALAVLAYFGKEYIWPLDDGTSAGFVASAPGGGTSRSIVETLKSTKK
NVVVFYGTQTGTAEDYASKLSKELASNFGLKTMTADVADYDFEDFDKISSDALCFFLMAT
YGEGEPTDNAIDFVNYLDNEADTLSNLRFSVFGLGNSTYEFYNAIGKKVDQKLEELGAER
FAEYSQGDDGLGTMDEDFLAWKDAVFESLENNLGFERKEAHYEPSLKLVENASLTKDDPS
VSQGEPSKAYVKSASIEGPYDHQNPYISKITKTRELFNSSTRSCVHAEFDLSASNMKYST
GDHLAIWPSNCDENVLKFLKAFGLEKKLDTVFDLKVLDSTARTHFHTPITYGAVIRHHLE
ISGPISRQFLSSIAGFAPTEEAKETAKNWGSNKGSFAKEIHEKSFNIADALLHISGGEPW
TDVPFEFLIELIGHLQPRYYSISSSSASEKQLIHITAVVENEKKGDVLVSGVVTNLLKHI
EIDQNKTKEKPFVHYDLDGPRGKFSKHKLPVHVRRSTFKLPNSPSVPVILIGPGTGIAPF
RGFVRERVTQKKNQDVKIGKTLVYYGCRNENEDFLYKEEWPQYAQVLGDSFEMHTAFSRK
DPNAKLYVQHKVAENGKEINRLLEQEKAYIYVCGDALKMARDVQKALTKVIAEERGVSEE
RAAELIRSLKTQNRYQEDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctttagacacattggattactcggtcatggtgggcttggcgctcgccgtgttggca
tactttggaaaggagtatatttggccgctggatgatggaaccagtgctggtttcgtggcg
tcagcgcctggaggaggcacgtctcggagtattgtcgagacactcaaatccaccaaaaag
aacgtggttgtgttctacggaactcagaccggtacggccgaggactatgcttcgaaattg
tccaaggaattggcttctaattttggcttgaagacgatgaccgcagatgtggccgattac
gactttgaggatttcgacaaaatttcctctgacgccttgtgtttcttcttgatggccacc
tacggtgagggagagcccaccgacaacgccattgactttgtgaactacttggataacgaa
gctgatacgttgtccaacttgcggttttccgtgttcggtttgggaaattccacctacgaa
ttttacaatgccatcggcaaaaaagtcgaccaaaaattggaggagttgggtgccgagaga
ttcgcggagtactcgcagggtgacgatggtttgggcaccatggatgaggactttttggcg
tggaaagatgccgtttttgaatcgttggaaaacaatttgggtttcgaacgtaaggaggct
cattacgagccctccttgaagcttgtagaaaacgcctcgttgaccaaagatgatccttcg
gtgtcgcagggtgagccttccaaagcctacgtcaaaagtgcatccattgaaggtccttat
gaccatcaaaacccatacatttccaagatcaccaaaactcgtgagttgttcaactctagt
accagatcgtgtgttcacgctgaattcgacttgtctgcctccaacatgaaatattccacc
ggagaccatttggcaatttggccctccaattgcgacgaaaacgtcctcaaatttttgaag
gctttcggattggagaagaaacttgacactgtgttcgacctcaaggttttggactccact
gcccgtacccactttcacacacccatcacttatggtgccgttataagacaccatttggag
atttcgggaccaatttctcgtcagtttttatcgtcgattgccggctttgcgccaactgaa
gaggccaaggaaactgccaagaactggggtagcaacaagggatcttttgctaaggaaatt
catgaaaaatcgttcaatattgccgatgctctcttacacattagcggcggtgaaccatgg
actgatgttcctttcgagttccttatcgagctgattggccatctccagcctcgttactac
tccatctcgtcgtcgtcggcatctgaaaagcagctgatccacattaccgcggtggtggag
aacgagaagaagggcgatgttcttgtttccggagtcgtcaccaacttgttgaaacacatc
gagatcgaccagaacaaaaccaaggaaaagccctttgtacattatgacttggacgggcct
cgtggaaagttttccaagcacaaacttccagtgcatgttaggcggtctaccttcaagttg
cccaacagtccgtcggtgccagtgattttgattggtccaggtactggtattgcaccattt
agagggtttgttcgtgagcgtgtgacccagaaaaagaaccaggatgtcaagattggtaag
actcttgtgtactatggatgtcgaaacgaaaacgaagactttttgtacaaggaagaatgg
ccccagtatgcccaagttttgggagattcgtttgaaatgcacacagcattttcgagaaag
gaccccaatgccaagctgtatgtccagcacaaggttgccgagaacggaaaggaaatcaac
cggttgttggagcaagaaaaagcctatatttatgtgtgtggagatgccctgaaaatggcc
cgtgatgtgcaaaaagcgttgaccaaggtgattgccgaagaacgaggcgtgagcgaagag
cgtgccgccgagctcatcagatcactcaagacgcaaaacaggtaccaggaggatgtgtgg
tag

DBGET integrated database retrieval system