KEGG   Meyerozyma guilliermondii: PGUG_04594Help
Entry
PGUG_04594        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pgu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pgu00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:pgu00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 428 aa AA seqDB search
MRILLLFIFGFSLTLAFDNGLGKKPQMGWNSWNKFACNINETVILQTAEKMKELGLLEYG
YEYIVMDDCYALKERDPISHKMVEDAAKFPNGIRSLSRRIHELGFKFGMYSSAGKYTCAG
YPGSLHYEKIDAETFVNDWEIDYLKYDNCFNEGNSGTPQISYQRYEAMSKALLQTGRPVF
YSLCQWGEDQVWDWGSTVANSWRITGDIYDSFDRYDDRCPCQTYDCRAVQGGMCSMTNIL
EKAVPLGQKAGPFLGWNDLDSLEVGNGGMSTDEYKAHFTLWAILKSPLVLGNDVTDMSKE
DFNIVTNKAIIAINQDDSNPAYRVWKKPVSGGHLHLFTNILKDGTFAVTLFNSGNKVNNT
VLNFEDIFLTDRVNAAKSFEFTELWTNETTLVSKELSTSIDAHLVKIWWLNCPKDICNKT
TSVMHDEL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcctattacttttcatttttgggttttctttgactttagcatttgacaatggc
ttgggaaagaagccgcaaatgggctggaactcgtggaacaagtttgcatgcaacatcaat
gagacggttatccttcaaaccgccgagaaaatgaaagagcttggtcttttggagtatggc
tacgaatatatagtcatggacgattgttatgcgttgaaggaacgggaccccatatcgcat
aaaatggtggaagatgctgcaaaatttccaaatggtatacgcagtctctccaggaggatc
catgaattggggttcaaatttggtatgtattcttcggcgggaaagtacacctgtgctgga
taccctgggtccttacactatgaaaaaattgatgctgaaacgtttgtcaatgattgggaa
atcgactacttgaaatacgacaattgcttcaatgaaggtaatagtggaactccccaaatc
agctaccaaagatacgaggcaatgtccaaagcacttctacagaccggaagacctgttttc
tactccttgtgccaatggggagaagaccaggtttgggactggggttcaacggttgcaaat
tcttggcgcatcaccggcgatatatacgactcttttgatcgctacgacgataggtgtccc
tgtcagacttatgattgcagagccgtccagggtggtatgtgctccatgaccaacatacta
gagaaagctgtacctttaggtcaaaaggctggtccatttctgggatggaacgacttggat
agcttggaagttggtaatggtggaatgtctaccgacgagtacaaggcacatttcaccttg
tgggcaattctcaagagccctctagtgttgggcaacgatgtaactgatatgtcaaaggaa
gattttaacatcgtcaccaataaggcaattatcgctatcaaccaagacgactcaaatcca
gcatatcgagtgtggaaaaaacctgttagtggtggtcatttacacttgttcaccaacatt
ttgaaagatggaacatttgctgtaactttgttcaatagcggcaacaaagtgaataacact
gttttgaactttgaagatattttcctcactgatagagttaatgctgcaaaaagtttcgaa
ttcaccgaattatggacaaacgaaactactttggtgagcaaagaattgtcaacgtcaatt
gatgcccacctggtaaaaatatggtggttgaactgtcctaaggatatatgtaacaagacc
acgagtgttatgcacgatgaattatag

DBGET integrated database retrieval system