KEGG   Meyerozyma guilliermondii: PGUG_04667Help
Entry
PGUG_04667        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MDSYVNRRIWNTISDHMDEITDLLPSNTGRMSLTTSLTRALKVDLGCDVVEAKDATDKEL
TSFHGKEFVTELLRQRGSNVEEIDDEKEAHFNKTSHLEKFGLVYDCPLFCGLDRYVRAVA
GSSINSARKLLSDTKDHLLAINWYGGRHHCQKNRAAGFCYVNDIVMAINVLRRRYRKVFY
LDLDLHHGDGVESAFEHSSSVLTCSIHRYDVGFFPGTGSLKSNTATKVNIPTEKGLSDKT
LATIMAEIVYPVILKFKPDAFVVQLGCDGLSTDPAKEWNLTIQGMGSIVEDLLRFVEPKP
CLFLGGGGYNHTEAAKFWTYITSIISGIDTVRNIDEIPDHKHLEEYEHDGYLFWTPKNTT
ARSIADRNTSNYLHEVKTTILTNFS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtatgtcaaccgtagaatatggaataccatttccgaccatatggatgagatc
actgatctcttgccctccaacacgggcagaatgtcgctcacaacttccttaactcgagct
ttaaaagttgatcttggatgcgatgtagttgaagctaaagatgcaaccgataaagaattg
acgagttttcacggaaaagagtttgtgaccgaattgctaaggcagagaggaagcaacgtt
gaggaaattgacgacgaaaaggaagctcatttcaataaaacaagccatcttgaaaaattt
ggtcttgtctacgattgcccacttttctgtggattggacagatatgtcagggctgtggca
ggatctagtatcaattccgcgaggaaacttctatcagatacaaaagaccatctattagcc
atcaattggtatgggggaaggcaccactgtcaaaagaacagagcagctggattctgttac
gttaacgatattgtcatggctatcaatgtacttcgacgaaggtaccgcaaagttttctat
cttgatcttgatctccatcacggtgatggggtagaatctgcttttgagcactctagcagt
gttttaacatgttctattcaccgctatgacgttgggttctttcctggaactggtagttta
aagagcaatactgctaccaaggtcaatattccaacagagaaaggactttcagacaaaact
ttggccacaattatggcagaaatcgtctatccagtcattctgaaattcaaacctgatgct
tttgttgtacaattaggctgcgatggtctctctacagatccagctaaggaatggaatttg
actattcagggtatgggaagcatagttgaagatctcttgcggtttgtggagccaaaacca
tgtctttttcttggcggtggaggatacaaccatacagaagctgccaagttttggacatat
attaccagcataatctcaggaatcgacactgttcgcaatattgacgaaataccagaccac
aaacatttggaagaatacgagcacgatggctacttgttctggactcccaagaatacgaca
gctcgaagtattgcggacagaaacacttctaattaccttcatgaagtcaagacaacaatc
ttgaccaatttttcataa

DBGET integrated database retrieval system