KEGG   Meyerozyma guilliermondii: PGUG_04774Help
Entry
PGUG_04774        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pgu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 550 aa AA seqDB search
MKFWKLSSYVLAALVSAAAASGPSDGDAIADPNSAVVKLTAADYQSFIDSNPLVLAEFFA
PWCGYCKQLAPEFTKAANSLNETNPNIKLAQVDCTVEEELCMQHEIRGYPTLKVIRGSEN
KPDDYDGPREASGIVDYMVAQSKPAVQTIESADAAVAAIADLKKPAVIQILPADYKEGKQ
KENSTYFDVALARRKELTFLTIQDSDAVKALQDKFKSLKASKSPVYIAIQPGADDVVPLA
EKFSKDALEKFITTEKVPYFGEINRETYLAYMTSPIPLAYYFYNSPDQKEALEKTFNDLG
KKYRGKLNFVGLDATLFGRHAEILSMDPETIPLFAIQDVEANKKYGLDQKKNPNPSAKAI
TKFVEDFVAGKLSPIIKSQPLPTEEEVAAQPVVKLVAHNYESIVKDTSKDVFVKYYAEWC
GHCKQLAPTWDELASIYDSNKPDANVVIAKLEHPENDVDVPVPIEGYPTILLYPANGEID
EKTGLRVPVTFNGARNLEALIDFVKENGGHKVDGHALKEAKGGVVEDEDDEVVEEKKEEQ
EEKDVDHDEL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttggaaattatcttcgtacgtgttagcagcactcgtttctgccgctgccgca
tctggcccatccgatggcgatgccattgctgatccaaactcagctgtggtgaaattaact
gccgctgattaccaatctttcattgattccaatccgttggttttggcggaatttttcgcc
ccatggtgtggatactgtaaacagttggctccagagtttaccaaggctgccaactcgctc
aacgaaaccaaccccaatatcaagttggcacaggtggattgcacagttgaagaggaattg
tgtatgcaacatgaaattagaggctacccaacattgaaggtgatccgtggctctgaaaac
aagccagacgactatgatggtccaagagaggcctctggtattgtagactacatggtggcc
cagtccaagcccgcagttcaaaccatcgagtctgctgatgctgccgttgctgccatcgcc
gacctcaagaaacctgctgtgatccagattttgccagcagactataaggagggcaaacaa
aaggaaaattccacttacttcgacgtggctctggctcgcagaaaggagttgacattcctc
acaattcaggactccgacgctgtcaaggccttgcaagacaaattcaagagcttgaaggcc
agtaagtctcccgtgtacattgcgattcagccaggtgcagacgacgtagtaccattggct
gagaagttctccaaggatgctttagaaaagttcatcaccacagagaaggttccttacttt
ggtgaaatcaaccgtgaaacctacttggcctacatgacgtctccaatccctctcgcctac
tatttctacaacagtccagaccagaaggaagctttggagaagaccttcaatgacttgggt
aagaagtaccgtggaaagcttaactttgttggattggacgccactttgtttggtcgtcat
gccgagatcttgagcatggaccctgaaaccattcccttgttcgctatccaagacgtggaa
gccaacaagaagtacggtctcgaccaaaagaagaaccctaacccttcagctaaggccatt
actaaatttgttgaggacttcgttgccggcaagttgtcgccaatcatcaaatcccagcca
ttgcctactgaagaagaagttgctgcccagcctgttgtcaagttggtggcccacaactac
gaatctatcgtcaaggacacatcaaaagatgtctttgtcaagtattacgccgaatggtgt
ggtcactgtaaacaattggcccctacctgggacgaattggccagcatctacgactcgaac
aagccagatgccaacgtcgtcattgccaagttggaacacccagagaatgatgtcgatgtt
cctgtaccaatcgaaggttacccaactattttgttgtaccctgccaacggtgaaattgac
gagaagaccggattgagagtcccagttactttcaatggtgctcgtaaccttgaagccttg
atcgattttgtcaaagagaacggtggacacaaggtggatggccatgctttgaaggaagct
aagggaggtgttgtagaagacgaagatgacgaagtggttgaggagaagaaggaagaacaa
gaagaaaaggatgtcgaccacgacgagttgtaa

DBGET integrated database retrieval system