KEGG   Meyerozyma guilliermondii: PGUG_04777Help
Entry
PGUG_04777        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PGUG_04777
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_04777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1205 aa AA seqDB search
MTLEEAPGPSAPVTAPPEVEKLEYTTPKSSNPFRTQQISESATFQSKLPTLFPPPDIHSP
YKTLNRILDDLKYTVPYQNAHPGSSLLRSRPIEYSVNLSRIAAKKPKCATITINNDVAYA
PTIETVGVDSEGNMVPQSSQDQETVAPFTLTIIRGLVVCGTDIHHFRLSTIDSATNPFAT
TIDKHEYHLVKPSDISRTEAKVLDIHSTTSFIDDAMFRSANASTRHVLRATIFKSEFTND
DLWPLLNDEVIAKRYEEGAKRHPDLNLSPNAVPTSVHCIHTLLKVLRGPILLPPGDPIKT
ISLTKTSLDTQLDVDLLTSRLGFVTAGEDVVPPNLADNLELRESYIRKSIELIYVGANIK
QEPNSVNQQYSFSDNLSVVYRAINESDRHVNVTFASSHISNQLPFFTNLSATTYFQDELV
IRCYENTLKSDSKNKLHYADSLRSIINFKRGQSGQSNQKLQSYFNHLTQSGQFIGYEDYS
NALRVIGIDRPNENLTDDDIIAVYKAQYQEDPRNYSYFNKHLKVIANARESAILHNYIKN
EVLPLNIAMDDLGIEEITEDEVVITAYEFKLDDILQSNGFNSTASEILLLNRSLLSVAVN
RKSYQLMSYYERKIDTSKPGVSVHDALVLFNLEDVKYGDVEIITSFQNRIAKATDVEDIR
KLRAALRALAESRDLAILQSFLHSGKVDVLLLPAENWPSGLDNIGNTCYLNSLLQYYFCI
KPLRQMVLNFPNNATGLEEASERKIGGRKVELLEVHRSHQFVYHLQKLFFDMIHTNKRCV
APSKELAYLAFLPLSQPVGFGTHESKALVKLDESAGLAQGDELEPIMIDSRSPSPPFLPT
PNHSDDLMSGDKETRTILPILDEIDSTIEVGRQQDVTECIENVTFQLETALEPESLEEDG
EQFDLIKKLFYGKTQQTLTPMHKAGEQRISTERFFSLIINVSDHPKDIYDSLDNYFSEDI
VNLEDGQVKKSLTVAQLPEVLQFHVQRVLFDREKLMAYKSIEHIPFSERIYLDRYLETQD
LEILKKRDEVFQWRSEVRQIHELRNKILTPDPNSKLCIIDALVTTKKYLETKVVPSSSVA
VNPTTILNLQVHIDELKGKIEALDAKLEELTSKISAQFTDYTKVGYSIFAIFIHRGEASY
GHYWVYIKDPHKNIFRKYNDEIVTEVPSSEVFNFVKENTATPYYIVYVKDSLEKDYVEPL
KRIIE
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaagaagctcctgggccttctgccccggtcacagcacccccagaagtcgaa
aaactggaatatacaactccaaagtcttcaaaccccttcagaacccaacaaatctccgaa
tcggccacgtttcagtcaaaactaccaaccctttttcctcctccagatattcattctccc
tataaaacactcaatcgtatcctcgacgacctcaagtacaccgtgccgtatcaaaacgcc
catcctggctcctcgctcctcagatcacggcccattgaatactctgtaaacctatctcga
attgctgccaaaaagcctaaatgtgctactatcaccatcaacaacgacgtggcgtatgcc
cctaccatcgagacggttggggtcgactccgaaggtaatatggtccctcaatcgtcgcag
gatcaagagacagtggctccattcacactcaccatcattcgaggattggtggtttgtggc
accgatatccatcatttccgactctccaccatcgattctgctaccaatcccttcgcaacg
actatcgacaaacacgagtaccatttggtcaaacctagcgatatttctcgcacagaagcc
aaagtactagacattcacagcactacttcttttatagacgatgccatgttccggtccgcc
aacgcatccactcgtcatgttctcagagccacgatattcaaaagcgagttcactaacgac
gatttatggccgcttctcaacgacgaggtcattgccaagcgatatgaagaaggtgcaaag
cgtcacccagacctcaatttgtcacctaatgctgtccccacttcggtacattgcatccac
acgcttctcaaggtgctcagaggaccaattcttctaccaccaggagaccccatcaagact
attagcttgaccaaaacatctctcgacacccaattggatgttgacctcctcacctctcgt
ttgggattcgtgacagctggagaggatgttgtaccgccaaatttggccgataacctagaa
ttgagagaatcttacattcgtaagagcattgagctcatctacgttggggctaatatcaag
caggagcctaactctgtcaaccaacagtattcgtttagtgacaatttgtccgtggtgtat
cgagccataaacgaatctgatagacatgtaaacgttacgtttgcatcgtcgcatatatcc
aatcaacttcccttcttcaccaacctcagtgctacaacatactttcaagacgaattggta
attcgatgctacgaaaacacgttgaaatcagacagcaagaataagcttcattacgccgac
tcactccgaagtatcataaacttcaaacgtggtcagtcaggtcaaagcaatcaaaagctt
caaagctatttcaatcatctcacacagagcggccaatttataggctacgaggactattca
aatgcattaagagttattggaatcgacagaccaaatgaaaacctcacagatgatgatatc
attgctgtgtacaaagctcagtatcaagaagatcctcgaaactactcgtactttaacaag
catcttaaagtcattgctaatgccagagagagtgcgattctccacaactatatcaagaac
gaagtgttgcctttgaatattgctatggatgatttggggattgaagaaatcaccgaggac
gaagtggtgatcacagcttatgagttcaagcttgacgatattttacagtcgaatggcttc
aattcaacggcatcagaaattttattgctcaacagatcacttctttccgttgcagtgaac
aggaaaagctatcagttaatgtcatactacgagcgcaagatagataccagtaaaccaggt
gtcagtgttcatgatgccttggttttgttcaaccttgaagacgtaaagtatggtgatgtc
gagataataacgtcgtttcaaaacaggatcgccaaagcaactgacgttgaagacattcga
aagttgcgagcagcattgagggcattggctgagtctagggatctggctatcctacagagc
tttttgcattcgggaaaggtggatgtactgctcttgcctgcagaaaattggccctctgga
cttgataacatcggaaacacatgttacctcaactcattactacagtactatttctgcatc
aagcctttgagacaaatggtactaaatttccctaacaatgctactggacttgaagaagca
tcagaaaggaaaattgggggccgaaaggtagaattgctggaagttcatcgttcacaccag
tttgtttatcatcttcaaaagctattttttgatatgatacatacaaacaaacggtgtgtt
gcacctagtaaagaattggcttatcttgcctttttgccgctttcacaaccagttggattt
ggaactcacgaaagcaaggctctagtcaagcttgatgaaagtgcagggttggcgcaagga
gatgagctggaaccaatcatgatcgactcacgatctccttctcctccatttttgcctacc
ccaaatcatagtgatgatctgatgtcaggtgataaagaaacccgtacaattcttcctatt
cttgacgaaatcgacagcacaatcgaagttggccgccagcaagatgttaccgagtgtatc
gagaatgtcacttttcagttggaaacggcattggaaccagaatctttagaagaagatgga
gaacaatttgatttgatcaagaagcttttctatggcaagacccaacagaccttgactcct
atgcacaaagcaggggaacaaagaatatccactgaaagattctttagcttgattatcaat
gtcagtgatcatccaaaagacatttacgattcgttggataactattttagtgaagacatt
gtcaatcttgaagatggacaggtgaagaagtcattgacggttgctcaactacctgaggtg
ttgcagttccatgtacagagagtcttgttcgaccgagaaaagttgatggcatataagtct
atcgagcacattccctttagcgaaaggatatatctagatcggtatttggagacgcaagat
ctggaaatcttgaagaaacgagacgaagtgtttcaatggcgatctgaggttcgtcaaatc
catgagcttcgtaacaagatactaacacctgatcccaacagcaaactatgcattatcgat
gccttggtgacaaccaagaagtacctagaaacgaaggtggtgcctagtagctcagtggca
gttaatcctaccacgattctgaatcttcaggtccatatcgatgaattgaaaggaaagatt
gaagctctcgatgctaagcttgaagagctcacttcaaagatatcggctcaattcactgac
tacaccaaggtcgggtactccatctttgccatattcattcaccgaggcgaggcaagctat
ggccattactgggtgtacattaaggaccctcacaaaaacatattcagaaagtacaatgat
gaaattgtaaccgaggttccgtcgtccgaagtgttcaactttgtcaaagaaaacactgcc
acgccatactacattgtctatgtaaaggactctttggaaaaagactacgtggagccattg
aagcgaatcattgaatag

DBGET integrated database retrieval system