KEGG   Meyerozyma guilliermondii: PGUG_04828Help
Entry
PGUG_04828        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGUG_04828
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGUG_04828
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PGUG_04828
Enzymes [BR:pgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PGUG_04828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 472 aa AA seqDB search
MSAAIKETFARCKKEGRNALVNFITAGFPTIPDTVPIMLAMQKGGVDIIELGIPFSDPIA
DGPTIQIANTKALENGITVPKCLELVKEARAAGVTVPIILMGYYNPILKYGEQKMIKDSA
AAGANGYIVVDLPPEDAVQFRASCATHGLSYVPLVAPATTDKRLKVLGSIADSFIYVVSR
MGTTGALKSVAKGIDELCQRVRKFAGDTPLAVGFGVSTRDHFLTVGEAADGVVIGSKIIT
LISEAAPEDRADTAYRFVRLILGDDYESKTHEFIAATPLETKQAQLPEEEHKYNPRFGDF
GGQYVPEALHACLAELERGFEDAVADPKFWEEFRSLYSYIGRPSSLHRADRLTEYAGGAQ
IWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLECQV
FMGAEDVRRQALNVFRMRILGAKVNAVRNGTQTLRDATSEAFRYWVSNLETT
NT seq 1417 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctatcaaagagacgtttgcacgctgcaagaaagaaggcagaaatgccctc
gtaaatttcattactgccggttttccaaccattcccgacaccgttcctatcatgttggcc
atgcaaaagggtggagtggacatcatcgagttgggaattccattttcggacccaattgcc
gacggacccacgattcaaatcgctaacactaaagctttggagaatggaatcaccgtcccc
aagtgtctcgaacttgtcaaagaagcaagagcagctggtgtaacggtccccatcattctt
atgggctactacaaccccattctcaaatatggcgagcaaaaaatgatcaaggactcggcc
gcagctggtgccaatggttacattgtcgtagaccttcctccagaagatgctgttcaattc
cgtgcttcttgtgctactcatggcttatcttatgtgccgcttgtagcacctgccaccacc
gacaagcgcttgaaagtattgggaagcatcgccgattcgtttatctatgtcgtttcccgt
atgggaacaaccggcgcattgaaaagcgtagccaaaggcatcgatgaactttgtcagcga
gtacggaaattcgctggtgataccccattggcggttggttttggagtttccaccagagac
cattttttgaccgtgggagaggccgcagatggtgtggttattggctctaaaattatcacc
cttatttctgaagcagctcctgaagatagagcggatacagcgtaccgctttgttcgtctg
attttgggcgacgactacgagtccaagacccatgagtttattgctgcgacccctctggaa
accaaacaggcccaattgccagaagaggaacacaagtacaaccctagatttggagacttt
ggaggtcaatacgtacccgaagctttgcacgcttgcttagccgaactcgagcgtggtttc
gaagatgcggtagcagaccctaaattttgggaggaattcaggtcgttgtactcctacatt
ggccgcccttcgtcgctccaccgtgctgatagattgaccgaatatgctggcggtgctcag
atctggctcaagcgtgaggatctcaaccacaccggttcccacaagatcaataatgctttg
gcccaggttcttattgccaaaagactaggcaagaaaaaaatcatcgcagagaccggtgcc
ggacagcatggtgttgctactgctaccgcctgtgctaaatttggtttggagtgtcaggtg
ttcatgggagctgaagatgtcaggagacaagcgcttaatgtctttaggatgagaatcttg
ggagcaaaggtcaatgctgttagaaatggtactcagactcttcgtgatgccacttcggaa
gcattcagatactgggtgtccaacttggagaccacga

DBGET integrated database retrieval system