KEGG   Meyerozyma guilliermondii: PGUG_04871Help
Entry
PGUG_04871        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pgu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pgu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 486 aa AA seqDB search
MSESVDSVDITKLNALAAGTNRKTPRIVAAGVGGRLMGTKSLVNVTADQITEDSMKQMTL
AEKDEAERQKYTRETHISDQPWTFSNWYQHINWLNLMLVVVFPLYGMWEATKHPLQWKTA
LLGFILYLALGLSITAGYHRLFSHTAYLASTPVRLFYAIVGAGAIQGSIKWWAHSHRVHH
RYTDTPRDPYDARQGLWYSHMGWMLVKANPKNRARADISDLTSDWVVRFQHRHYLTLMLL
MSLVLPTIIAGVFWGDWWGGFIYGGIFKSFVIQQATFCVNSLAHWIGSQPFDDRRTPRDH
VITALATFGEGYHNFHHEFPSDYRNALKWYQYDPTKMVIWGLSKIGMAWNLKTFSQNAIE
QGLLQQQEKKLEQMRQKLRWGEQVDALPVMEREEFNERSKKDGLILIAGIVHDCKSFIKE
HPGGQALIRASLGKDATKAFNGAVYRHSNAAHNMLAGMRIAVLRDSDVSSNTFQLQQEYL
EKEKVN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaagtgttgattctgtagacatcaccaaattgaacgctttggctgctggcacc
aaccgcaagaccccgagaattgtggcggcaggtgtgggtggtcgtttgatgggaacaaag
tctcttgtcaatgttactgctgaccaaatcacggaagactcaatgaaacagatgactttg
gcagagaaggatgaggccgaacgtcagaaatatactcgggaaacccatatttccgatcaa
ccatggacatttagtaactggtaccaacatattaattggttgaacttgatgttggttgtt
gtatttccactctatggaatgtgggaagcaactaaacatcctcttcaatggaaaacggcc
cttcttgggtttatattgtatttggcgctgggactttcaattactgctggttaccatcgt
ttattttctcacacagcctacctggcttcaactcctgtgaggttattttatgccattgtt
ggtgctggtgccattcaaggctcgatcaaatggtgggctcactctcacagagttcaccat
cgttatacagacactccaagagacccctatgatgctcgtcaaggattgtggtactcgcac
atgggatggatgttggttaaggccaatccaaagaaccgtgcacgtgctgacatttccgat
ttgacttctgactgggtagttagatttcaacatcgtcactaccttactttgatgcttttg
atgtcacttgtattgcccactatcattgctggtgttttctggggtgactggtggggaggg
ttcatttatggaggaatcttcaaatcgtttgttattcaacaagctaccttctgtgtcaac
tcattggcccattggatcggctctcaaccattcgatgaccgcagaacccctcgtgaccac
gtcattaccgctttggctacttttggtgaaggttaccacaatttccaccacgagtttccc
tcggactacagaaacgcattgaaatggtaccaatacgacccaaccaagatggtgatttgg
ggattgtctaagattggtatggcttggaacttgaagacttttagtcaaaatgccatcgaa
caaggtttactccagcaacaagaaaagaagttggagcaaatgcgccagaaattgagatgg
ggtgaacaagtggatgctctcccagtgatggaacgcgaagagtttaatgagagatccaag
aaagacggacttatcttgattgctggtattgttcacgactgtaaatcttttatcaaggaa
catcctggaggtcaagccctcatcagagcatcgttgggtaaggatgctaccaaggctttc
aacggagctgtatatagacactcaaatgctgcacacaacatgttggcaggaatgagaatt
gcagtgttgcgtgatagtgatgtcagctccaacacattccaacttcaacaggaatacttg
gaaaaggaaaaggttaactag

DBGET integrated database retrieval system