KEGG   Meyerozyma guilliermondii: PGUG_05024Help
Entry
PGUG_05024        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00010  Glycolysis / Gluconeogenesis
pgu00260  Glycine, serine and threonine metabolism
pgu00680  Methane metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01200  Carbon metabolism
pgu01230  Biosynthesis of amino acids
Module
pgu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pgu_M00002  Glycolysis, core module involving three-carbon compounds
pgu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGUG_05024
  Energy metabolism
   00680 Methane metabolism
    PGUG_05024
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGUG_05024
Enzymes [BR:pgu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PGUG_05024
Membrane trafficking [BR:pgu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PGUG_05024
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PGUG_05024
  Exosomal proteins of melanoma cells
   PGUG_05024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 5124548
NCBI-ProteinID: XP_001483069
UniProt: A5DP23
AA seq 287 aa AA seqDB search
MVPPLSHHLQPESVHPSASTHPHTRRSVYKPCGRAPIAKMPKLILIRHGQSEWNEKNLFT
GWVDCKLSDVGRKEAARAGELIKEKGLVADVLYTSKLSRAIQTANIALEAADQLYIPVKR
SWRLNERHYGALQGKDKAATLEQYGKEKFQTWRRSFDIPPPTIEDSSEFSQAGDIRYKEI
DPAALPKTESLKLVIDRLLPYWQDELSRDLLDDKVVLVVAHGNSLRALVKHLDKISDEEI
AGLNIPTGIPLVYELDAELKPTKPAYYLDPEAAEAGAAAVAAQGQKK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggttccaccacttagccaccatttgcagccggagtccgtacacccgagtgcatccaca
cacccacacacccggcggtccgtatataagccgtgcggccgcgccccgatcgccaaaatg
ccaaaattgattttgattagacacggccaatccgagtggaacgagaaaaacttgttcaca
ggatgggtagactgtaagttgtccgacgtgggcagaaaggaggctgctagagcaggagaa
ttgatcaaagaaaagggcttggtggctgatgttttgtacacttccaagttgtccagagcc
atccaaactgccaacattgctttggaagctgccgaccaattgtacattcccgtcaagaga
tcgtggagattgaacgagagacattatggtgctttgcagggcaaggataaggccgccact
ttggaacaatacggaaaggaaaagttccagacatggagaagatcgtttgacattcctcct
ccaaccattgaggactcttctgagttttcccaggccggggatatccgttacaaagaaatt
gaccccgctgctttgccaaaaaccgagtcgttgaagttggttattgacagattgttgccc
tactggcaagacgaactctcgcgtgatttgttggacgacaaggtggttttggtggtggcc
cacggtaactcgttgcgtgctttggtcaagcacttggacaagatttctgacgaagaaatt
gccggtttgaatatccctaccggtattcctttggtttacgagttggacgccgagttgaag
ccaaccaagccagcttactacttggaccccgaagctgctgaggccggtgctgccgctgtt
gctgcccagggacaaaagaagtga

DBGET integrated database retrieval system