KEGG   Meyerozyma guilliermondii: PGUG_05024Help
Entry
PGUG_05024        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGUG_05024
   01230 Biosynthesis of amino acids
    PGUG_05024
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGUG_05024
  Energy metabolism
   00680 Methane metabolism
    PGUG_05024
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGUG_05024
Enzymes [BR:pgu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PGUG_05024
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PGUG_05024
  Exosomal proteins of melanoma cells
   PGUG_05024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 287 aa AA seqDB search
MVPPLSHHLQPESVHPSASTHPHTRRSVYKPCGRAPIAKMPKLILIRHGQSEWNEKNLFT
GWVDCKLSDVGRKEAARAGELIKEKGLVADVLYTSKLSRAIQTANIALEAADQLYIPVKR
SWRLNERHYGALQGKDKAATLEQYGKEKFQTWRRSFDIPPPTIEDSSEFSQAGDIRYKEI
DPAALPKTESLKLVIDRLLPYWQDELSRDLLDDKVVLVVAHGNSLRALVKHLDKISDEEI
AGLNIPTGIPLVYELDAELKPTKPAYYLDPEAAEAGAAAVAAQGQKK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggttccaccacttagccaccatttgcagccggagtccgtacacccgagtgcatccaca
cacccacacacccggcggtccgtatataagccgtgcggccgcgccccgatcgccaaaatg
ccaaaattgattttgattagacacggccaatccgagtggaacgagaaaaacttgttcaca
ggatgggtagactgtaagttgtccgacgtgggcagaaaggaggctgctagagcaggagaa
ttgatcaaagaaaagggcttggtggctgatgttttgtacacttccaagttgtccagagcc
atccaaactgccaacattgctttggaagctgccgaccaattgtacattcccgtcaagaga
tcgtggagattgaacgagagacattatggtgctttgcagggcaaggataaggccgccact
ttggaacaatacggaaaggaaaagttccagacatggagaagatcgtttgacattcctcct
ccaaccattgaggactcttctgagttttcccaggccggggatatccgttacaaagaaatt
gaccccgctgctttgccaaaaaccgagtcgttgaagttggttattgacagattgttgccc
tactggcaagacgaactctcgcgtgatttgttggacgacaaggtggttttggtggtggcc
cacggtaactcgttgcgtgctttggtcaagcacttggacaagatttctgacgaagaaatt
gccggtttgaatatccctaccggtattcctttggtttacgagttggacgccgagttgaag
ccaaccaagccagcttactacttggaccccgaagctgctgaggccggtgctgccgctgtt
gctgcccagggacaaaagaagtga

DBGET integrated database retrieval system