KEGG   Meyerozyma guilliermondii: PGUG_05030Help
Entry
PGUG_05030        CDS       T01150                                 

Definition
similar to porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGUG_05030
Enzymes [BR:pgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PGUG_05030
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_05030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MVHQAEFLAPTGTNISSVLQGGYNHPLSREWQSERQLTKNMFIFPLFILDDENEELDIAS
LPNIKRRGLNKLVPYVDSLVQKGLRAVILFGVPLKEGVKDELGTAADDPEGPVIAGIKLL
RQNFPDLFIMCDVCLCEYTDHGHCGVLNEDGSLNREKSSLRLGAVAVNYAKAGANSVAPS
DMVDGRVRDIKLGLIEAGLAHKCLLMAYSAKFSGGLYGPFRDAAGSAPSHGDRKCYQLPP
TGSGLARRALTRDILEGADAVIVKPSTFYLDILSDAARLCKDYPICAYHVSGEYAMLHAA
AEKGVVDLKQIAFESHNGLLRAGARLIISYFTPEFLEWLEV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaccaagcagagtttctagcgcccaccggcaccaacatctcgtcggttctccaa
ggcggttacaaccacccgctctctcgagagtggcagagtgagcggcagttgacgaaaaac
atgttcatattcccacttttcattctggacgacgaaaatgaagaactggatatcgccagt
cttcccaatataaaacgcagaggcctcaacaagttggttccgtatgtggacagcttggtc
cagaagggccttagggccgtgatactcttcggagtgcctttgaaagagggagttaaggac
gagttgggcaccgctgccgacgacccagagggcccagtcatcgcaggaatcaagttgtta
cgtcaaaacttcccagacttgttcatcatgtgtgatgtgtgcttatgcgagtacactgat
cacggtcactgtggagttttgaacgaagacggaagcttgaatcgtgaaaaatcgtcgctt
cgtcttggagccgtcgctgttaattatgccaaagccggtgccaactcggtggctccttca
gacatggtagacggacgagtccgtgacatcaagctaggcttaattgaggctggacttgct
cacaaatgcttgcttatggcatattccgccaagttcagtggtggattatacggtcctttc
agagacgctgctggctctgcacccagccatggcgacagaaaatgctaccagcttcctcca
accgggtctgggttggctagaagagcattgacaagagacattctggaaggagcagatgcc
gtcattgttaaaccttcgactttttaccttgatattctcagcgatgcagccagattgtgc
aaagattaccccatttgcgcctaccatgtgtccggagagtacgccatgttgcatgccgcg
gcagagaagggggtggtggacctcaagcaaattgcgtttgaaagccacaacggtttgctc
cgtgctggtgcccggctcatcatcagttacttcactccagagttcttggagtggttggag
gtttga

DBGET integrated database retrieval system