KEGG   Meyerozyma guilliermondii: PGUG_05077Help
Entry
PGUG_05077        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PGUG_05077
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PGUG_05077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MSQEPDLLSPSMSANYKRRRGSSVGKINLGDTSPALATMYRSKAQRSKSSDRIMELSRES
KSDLAILRKMYVGFIELTYRHTWIVPFIILSVFFSAFFLSGPGTRVHNFLDACIVLAYHI
PGTDQYGKGENDFYFVGFYAIFFIFLREFMMCVVLRPLATFAGMKKEGKKKRFMEQAYAL
FYYGVSGPFGLWIMHGLPLWFFETTPFYTNYPHKTHDYYFKVFYLGQAAFWVQQCIVLIL
QLEKPRKDFYELVLHHIITIALIWCSYRFHFTWMGIEVFVTMDVSDFFLAASKTLNYLDS
PTTGPFMVVFVAVWVYLRHYVNLKILWSVLTEFRTVGEWELNWDTQQYKCWISQPIVFGL
IGALQIVNIYWLFLIIRIMYRYVAAGVAKDERSDDEDEESDSQEEIAKTKKEE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagcctgacttgttatcccctagcatgtcggccaattacaagagaagaaga
ggatcctccgttggaaaaattaatctaggtgatacttcgcctgctcttgctactatgtac
cgttcaaaagcgcaacggtcaaagtcgagcgacagaataatggagttgtcgagagaaagc
aagtcggatttggctatcttgagaaagatgtacgtgggtttcattgagcttacatatagg
cacacgtggatcgttcctttcatcattttgtcggtgttttttagtgctttcttcttgtca
gggccaggtacccgagtacacaatttcttggacgcatgcattgtattagcctaccatatt
cctggaacagatcaatatggaaagggtgaaaacgacttttattttgtgggcttttacgcc
atttttttcatatttttgcgtgagttcatgatgtgtgttgtcttgcgtccgcttgcaact
ttcgccggaatgaaaaaagaaggaaaaaagaagaggttcatggaacaagcctacgcattg
ttttattacggtgtctccggtccgtttggtttgtggatcatgcacggtttacctctttgg
ttttttgaaactactccattttacaccaactaccctcataagacccatgactactatttc
aaggttttctatttgggtcaagcagcattttgggtacagcaatgtatcgtactcatttta
caattggaaaagcctcgcaaagacttttacgagcttgtgttgcatcacattatcacaatt
gcgttgatctggtgctcgtatagatttcattttacttggatgggaatagaagtcttcgtt
accatggatgtgtctgatttctttttagcagcttcgaagacattaaactatttggactct
cctacaactggccccttcatggttgttttcgttgctgtttgggtatacttgagacattat
gtgaacttgaagatcttgtggtccgttttgactgaattcagaaccgttggtgagtgggaa
ttaaattgggacactcaacaatacaagtgttggatttctcaaccaattgtttttggattg
attggcgctttacagattgtgaacatttattggctcttcttgatcatcagaatcatgtac
agatatgtggctgctggtgtggcaaaggatgaaagaagtgacgacgaagacgaggagagt
gatagccaggaagaaatagcgaagaccaaaaaggaagaataa

DBGET integrated database retrieval system