KEGG   Meyerozyma guilliermondii: PGUG_05202Help
Entry
PGUG_05202        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_05202
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_05202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 687 aa AA seqDB search
MTQDHPAPPTLLPYGDGSSKVYGMENFGNTCYCNSILQCLYYSDKFRTKLALHNITQHNR
KEVMAGVKNHNFTLKYELLVQKRLREQPKNAAIENGTSERVKPTRKGSLFGLKFNTSTTN
SVNTSSTDDSLRKWYITEAKNCDALLAEQKLLIRKNPEFQDLPVMVTRHTSSPLELAEKS
DNSQSSSMLLNEKTEKSNTPTSVKEGSITSQSCFIIVGIPQPEVDLVNPINPFNPNPSSD
HRKRSALINGPIINLDHSLQLPTQQSDETALLYALKDMFECMIENKSQIGVVSPSHFITK
LKEKNYLFRQVNMHQDAHEFYNYLINEIIEVVDKECGPNNNWCNEIFQGMITNETKCISC
ETITSKEEEFLDLSIDIPPGDAAYSLTHCLNNFSRLETLTHQNKFYCNNCCSLQEATKTI
KLKKLPEVLVINFKRFKYDESVDKMVKLFDSISYPFKLRLFNTSAKGQTEDFTLYELYAL
VIHIGGGPMHGHYVALCKVKAQLWLLFDDETVEVVDDSFVLKFFGNGPGLASAYILFYQK
VHMAGLLGFKEEDVYCGEDWLPQRHNSAETVQAKSQPEVWSTHSSESGSTDSIKDLSSSA
VFDKNPFKKNYKIENKEDTISRTSSTKEKQPEKKTWVGGLKRRQSKNDVPTDRKASTGSV
MSTPSTNSDKEKRKSFFGFKRKQKLEK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggaccatcccgctcctcccacgctgctcccatatggagacggctcgagcaag
gtttacggtatggagaactttggcaatacctgctattgtaactcaatccttcaatgttta
tactattccgacaaatttcgaaccaagttagctctccacaatatcacccaacacaaccga
aaagaggtgatggctggggttaaaaaccacaatttcactctcaagtacgagctgttggtc
cagaaacgtttgcgtgaacaaccgaaaaatgcagccatagaaaacggtacttctgaacga
gtaaaacccacgagaaaaggatcattatttggactcaagttcaacaccagcacaacaaac
agcgtcaacaccagctccacagacgatagcctgagaaaatggtacatcacagaagccaaa
aactgtgacgctttgctggcagaacagaaactcttgattcgcaaaaatcccgaattccaa
gatcttccagtaatggtcaccagacacacgtcttcgccgttggaattggcggaaaagagc
gacaattcgcagtcgtcatcgatgcttcttaatgaaaaaactgaaaaaagtaataccccc
acatctgtcaaagaaggctccatcacatcccagtcgtgcttcattatcgtgggtattccc
caacccgaagtcgacttggtcaatcccatcaaccccttcaaccccaatccctcatcagac
caccgcaaaagatctgctctcatcaatggacccattatcaacctcgatcattcgcttcaa
cttcccacccaacagtccgacgaaaccgccttgctctatgctctcaaggacatgttcgag
tgtatgatcgagaacaagtctcagattggcgtggtttctccttcacattttataaccaaa
ctcaaggagaaaaactatctttttcgccaggtgaatatgcaccaagatgcccacgaattt
tacaactatttgatcaacgaaatcatcgaagttgtggacaaagaatgcggtcccaataac
aactggtgcaacgagatctttcaaggaatgatcaccaacgaaaccaaatgcatttcttgc
gaaaccatcacctccaaagaagaggagtttctcgacttgtccatcgatattccaccggga
gacgccgcctactcgttgacccactgcctcaacaacttctcgcggctggaaacactcacc
caccaaaacaaattctactgcaacaattgctgctctctccaagaagccaccaaaaccatc
aagctcaaaaagctccccgaagtgctcgtgatcaacttcaagcggttcaagtacgacgag
tccgtagacaaaatggtcaagttgtttgattccatatcgtacccgttcaagctcaggctc
ttcaatacctcagcaaagggtcaaaccgaagactttactctctacgaactatacgctctt
gtgatccatattggtggaggtcccatgcacggtcattatgtggctttatgcaaagtaaag
gctcaattatggctactttttgacgacgaaacggtggaagttgttgacgattctttcgtt
ctcaagttctttggcaatggtccaggactagctagtgcctatattctcttttaccaaaag
gtccacatggcaggtttattgggattcaaagaggaggacgtttattgtggagaagactgg
ttgccccaaagacacaattcggctgagactgtccaggcaaaaagccaaccggaagtatgg
tctacccacagctcggaaagtggatcgacagactcgataaaagatttatcaagcagtgcc
gtttttgacaaaaacccattcaaaaagaactacaaaattgagaataaagaagatacgatt
tcaagaacctcatcaacgaaagaaaaacaaccagaaaagaaaacttgggttggaggactc
aaaagaagacaatctaaaaacgatgttcccactgaccggaaggcttcgaccggaagtgta
atgagcactccaagcaccaattccgataaagaaaagagaaagagcttttttgggttcaag
agaaagcaaaagctggagaagtga

DBGET integrated database retrieval system