KEGG   Meyerozyma guilliermondii: PGUG_05376Help
Entry
PGUG_05376        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pgu00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 284 aa AA seqDB search
MSQNEPNPLVIFSTLAAIILAAVAVYVVKLNKKNGPVLKPDVFQKFPLIEKTRLSHNTCI
YRFGLPKSTDRLGLPIGQHISIGATINGKEVVRSYTPISRDDELGYFDLLIKTYEQGNIS
RHVDSKSVGDHIEVRGPKGFFTYTPNMVEHLGMIAGGTGIAPMYQVLTAILTNPDDKTKI
SLVYANVTEEDILLRAELDLFAKEHPDRFKVHYVLNNAPENWNGSVGFVTPEIMEKHLPN
KDQDGYLLLCGPPPMISAMKKNAVTLGYPKARPVSKLGDKVFVF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaacgaacccaaccctttggtcatcttctccacccttgccgccatcattttg
gccgccgtggccgtgtacgttgttaaactcaacaagaaaaatggtcctgttttgaaacct
gatgtgtttcaaaaattcccattgatcgagaagactagactctcccacaacacttgtatt
taccgttttggtttgcccaagtccaccgatcgtcttggcttgcccattggccagcacatc
tccattggggccaccatcaatggaaaggaagtggtgagatcgtacactcctatttctaga
gatgacgagttgggttactttgatttgctcatcaagacgtacgagcaaggtaacatttcg
cgtcatgtggacagtaagtctgttggagaccacattgaagtcagaggaccaaaaggtttc
ttcacttacacccctaacatggttgaacacttgggcatgattgccggaggtactggtatc
gctccaatgtaccaggttttaactgctattttgaccaacccggatgataagactaagatc
tctttggtgtatgctaatgttactgaagaggatattttgttgagagccgaattggacttg
tttgccaaggaacaccccgacagattcaaggtgcactacgttttgaacaacgctcccgag
aactggaacggcagtgtcggatttgttacaccggaaataatggagaagcatttacccaac
aaggaccaagatggttacttattattatgtggtcccccacccatgatcagcgccatgaaa
aagaacgccgtcactcttgggtaccccaaggccagaccagtgtccaagttgggcgacaag
gtttttgttttctag

DBGET integrated database retrieval system