KEGG   Meyerozyma guilliermondii: PGUG_05505Help
Entry
PGUG_05505        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pgu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 737 aa AA seqDB search
MGDSGARSKLPAGYKQGVSRPFYSTFVDLQLLKNGKVSRKDKLFMLILVAVGIIVRAYKL
PTPPRAVFDEVHYLGYALDYLHGDFFVDVHPPLAKLIFYWITLFLSPGANADTLKVGDKF
DPSLPYVALRLFPVVCGILAIVLSYRLLRVSGCRSWISFTGAFLVAIENSLVTQSRLILI
DAPLIFAISLTVFAIQKADLVTPFTRKWYQFIIVAGLGLGAAMSIKWVGFFTAAWVACIS
VLQLWNLLGDLDVSDRKWFAHLGVRLGAFVALPLTIYCSLFAVHFHLLPYGGLASGMLSP
SFQATFKDATQAMPVQVLYGSTVTIKHNSLDFYLHSHNFTYKGGSGEQQVTLYGQSFDGN
NEWIIETQNKTPEGALQKDYKEVKDGDVVRLYHKFTGKYLHVNDVRPPISEHDYSNEVSC
AGDRDLLGDSNYEFTIRILAKKSHSKNDLPMIKLRATETIFQLIHRGTLCVVMSHKDKLP
EWGHFQNEVLCVDEPTIPNTMWYVASNSHPLTDNDDKYERVHYKNLTFFDKLWEYHVVMW
RVNAGLSGKKHPYASTPESWPFLTRGINYFTHRSARGGNNSDELGLHIYLIGNPVIYIAA
FITIIIVVFSKGLYLIIALNPFKIPDQNATQEIYHRSSFRFLMGWVLHYFPYFWMTRELY
MHHYLVPLYFSVLLLVQFAEYQVSQRRWVGYAVLASIVAGSIYYFIRLLPIIYGTAWTRE
GCLGARGIWDFDCSVFE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattctggggcaagaagtaaactacctgcgggttacaagcagggagtttcaaga
cctttctactccacgtttgtcgatctgcaattgctaaagaatggcaaggtttcacgaaag
gacaaactttttatgctaatcctagtggctgttggaatcatagtccgagcatacaagtta
cccactcctccacgagcggtattcgatgaagtccattacctaggctacgcactggactac
cttcatggtgactttttcgttgatgtccatcctcctttggccaaattgatattttattgg
attacgttattcctctctccaggagcgaatgctgatactcttaaggttggagacaaattt
gatccaagtttaccttatgtggcccttcgtttgtttcccgtggtatgtggaatactcgca
attgtgttatcatatcgtctacttcgtgtttcaggatgcagaagttggatctcgtttacg
ggagccttcttggtagccattgaaaactcgttagtgacgcaatcgcggttgattttgatc
gacgctccattgatattcgctatcagtcttacagtgtttgcaattcaaaaggctgatttg
gtaactccattcacgaggaagtggtaccagtttataatagtagctggtttggggcttgga
gctgccatgtctatcaaatgggtgggctttttcacagcagcttgggttgcctgtataagt
gttctgcaattgtggaatttgcttggtgatctcgatgtatcagaccgtaaatggtttgca
catctaggtgtaagacttggtgccttcgtagcattgccacttacaatctactgcagtttg
tttgcggttcatttccaccttcttccttacggtggtctggcctctggaatgctttctcca
agttttcaagctactttcaaagacgctacccaagcgatgcctgttcaagttctctatgga
agcactgtgactatcaagcataacagtttagacttctatctccattcgcacaattttaca
tacaagggtggatctggagagcagcaggtaactttgtatgggcagtcttttgacgggaat
aatgaatggataattgagacacaaaacaaaacacctgagggagctttacaaaaggattat
aaagaagttaaggatggtgatgtggtacgattataccataaatttacaggcaagtatctc
catgtcaatgatgtgagacctccaatttcggagcatgactactccaacgaagtttcgtgt
gctggtgatcgcgatttgttgggagattccaactatgagttcaccataagaattcttgct
aaaaagtcccactcgaaaaacgatttacccatgataaagcttcgtgctacagagaccata
tttcagttgatacaccgaggtactctgtgtgttgttatgagccacaaggataagctacca
gaatggggccactttcagaacgaggttctttgtgttgacgagcccacgattcctaatacc
atgtggtatgtggcgtccaactcgcacccactcacagataacgatgacaagtacgaacgg
gtacactataaaaatctcacattttttgacaaattgtgggagtatcatgttgtcatgtgg
agagtaaacgcagggctctctggaaagaaacatccatatgcgtcgacccccgagtcatgg
ccctttttgaccagaggaatcaactattttacacatagatcggctcgtggtggaaataac
tctgacgagctggggctgcatatctatcttattggaaaccctgtcatctacattgctgct
ttcatcaccatcatcattgtggtattttccaaaggtctatacttgatcattgccttgaat
ccattcaagatcccagatcaaaatgcaacccaagaaatttaccatcgaagcagtttccga
ttcttgatgggatgggtactacactattttccatatttctggatgacccgtgagttgtac
atgcaccattatttggtacctttgtacttttcggttcttctacttgttcaatttgcagag
taccaagtgagccaaagaagatgggtgggatatgctgttttggcctcgattgtggcaggc
agtatttactactttatcaggttgctccctattatctacggcactgcgtggactcgggaa
ggatgtcttggtgccagaggtatttgggatttcgattgcagtgtttttgagtag

DBGET integrated database retrieval system