KEGG   Meyerozyma guilliermondii: PGUG_05512Help
Entry
PGUG_05512        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pgu  Meyerozyma guilliermondii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1402 aa AA seqDB search
MSQVFGPAPLQPLNEKMRHGFEEDYNSENFLNLLANSFYIYFDDKRHNATGNPIPDELKM
DPAHYKTYQPIHDWKVMKERQKTISAVLVLCLNLGVDPPDIMKTYPCAKYEAWCDPSLFP
DTKKAIESIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNTLRRNAKDERILFHYNGH
GVPQPTASGEIWVFNRGYTQYIPISLYDLQTWIGAPVIFVYDCNSAGNIVHNFKKFVQKR
IDDDNEGNHDMSAPSPTSAFLDSIQLAACKSNELLPMSPELPADLFSCCLTCPIDISIKW
FILQSPLKKNYYSLLPKNSVGNAIIPGKLTDRRTPLGELNWIFTAITDTIAWTTLSRPIF
KRLFRQDLMVAALFRNFLLAKRIMPHLNCNPISDPPLPDSVRHHPMWDSWDLAIDQVCAQ
LIRDDPEHKHKPVISDPIAPISANDNASGQANQIPGQPGYVNLPNYQHSTFFEQQLTAFE
IWLKFAGPSTKEPPEQLPIVLQVLLSQVHRLRALILLSKFLDLGPWAVYLSLSIGIFPYV
LKLLQSPAQELKPVLIFIWARIMAIDHKSTQQELCKDKGYNYFYLILNSSPGNLNGPVGA
PGGYSNTNILINDDHKAMSAFILTLFIKDFKNGQRLSFSVELIHNCLKFISTSENPLLRQ
WCCLLLSQLWNNYPDGKWINYKDGYLNKLLLMVNDPIPEVRTSVILALTTFLSDVDGESL
PQGSMNAALRKDELKQQDLKLANTILGLLGDGSPMVRKEIIFFIRKFINIYSKFFLVVSF
NQLEEEIVLIDNPNELNEFRKKSPAYGLIFSSIWKALLILTEDPHPEIKQLAEILVDQIM
LQLNKSELGQLVREMEEYLLSKSTLNMSQTFGQGAPSKPIINRQLNGDGRRQVSSGSTLQ
RNSSMQRNNNVLKITSRPRSVSTNNMEDSNHSDSDSVSSKLKNFSIAKLFKSLHISEETD
LKNFSRMLSSGPITSNYGAEYKPKSARFKPRDLTKEPKLPDESGFFQYSCEYFQEPQMSK
NEIDEPGSEEYVKRIWRRNRNESIIQETQPQKTMALRGDWNKNIRVMNNKSQPRLIKFTQ
FEKLLVACDDKDNMSVWDWEDCKLVKKFSNENPFGTKITDIKFLNEDDLPLVLTGSSDGV
VKIYKNFHLEDEQIELVASWRALTDLLLTSKSTGLVSDWQQSRGSLLVSGDVKIIRVWDA
PRELCLADIPARSSSSITSLTSDQVTGNLFVAGFDDGSVRVYDRRLDSRESMVRVWNGAK
AQPGVSSRRRYGHGSIRNTRMQRGGLRELVTGSSDGYVNLWDIRESEPVLTFTNEPEKSM
RCIDVHEHAPVITTGSKSVSLWSTSGDMVSVLKNPHESLLTNRTASYLTGTTFHPHRMML
ATNYNQDGHINVYSCSDIIQEY
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagtgttcgggcccgctcctttgcagcccttgaacgagaagatgcggcatggt
ttcgaggaagactacaactcagaaaactttctcaatctcctagccaactcgttctacatt
tattttgatgataaacgtcataatgctacgggcaatccgattcccgacgaattgaaaatg
gacccagctcactataaaacctaccagcccatccacgactggaaagtgatgaaggagcgc
cagaaaaccatcagtgctgttcttgttctttgtttgaacttgggtgtggatcctccagat
atcatgaagacttatccatgtgccaagtacgaggcttggtgtgacccgtcactctttccc
gatacgaaaaaagccatcgagtccattgggaaaaacctccaggcgcaatatgagacgcta
tctcttcgtactcgttataagcaatctctcgatccatgtgtcgaagacgtcaaaagattc
tgcaatactcttcgaagaaatgccaaagacgaacgaatattgttccattacaacggtcat
ggtgttccccaaccgacggcttcaggagaaatctgggtcttcaacagaggctatactcag
tacattcccatctctttatacgatcttcaaacctggataggtgctccagttatattcgtc
tacgattgtaacagtgctggaaacattgtccacaacttcaaaaagtttgtccagaagaga
atcgacgacgataacgagggaaaccacgatatgagtgctccgtctccaacgtctgcattt
ctcgatagcatccaacttgcagcatgtaaaagcaatgaacttcttcccatgagtcctgag
cttcccgcagacttgttttcgtgctgcttgacctgtcccatcgacattagcatcaaatgg
ttcattttgcaatcaccattgaagaaaaactactactcgcttctccccaaaaattcagtg
ggaaacgccataattcccggaaaattgaccgatagacgtacaccattgggagaactcaac
tggatcttcacagctataaccgacacaattgcttggaccacactttctcgtcccatattc
aaaagattgtttcgacaagatttgatggtggctgcactcttcagaaatttcttgctagcc
aagagaattatgccccacctcaactgcaaccccatcagtgatcccccgttgccagatagc
gttaggcaccaccctatgtgggactcgtgggacttggcgatcgaccaagtgtgtgcccag
ttgatcagagacgatccagaacataagcacaaaccggtaatttccgacccaattgcaccc
ataagtgccaatgacaatgccagcggccaagccaatcagattcctggccaaccaggctac
gtcaatttacccaattatcagcattccacgttctttgagcagcaacttacagcctttgaa
atatggctaaagtttgccggtccttcaaccaaagagcctccagaacaattgcccatcgtg
ctccaagtgctactttctcaagtgcatcgtttgagagctttgatattgttgtcgaaattt
ctcgacttgggcccttgggccgtatatctttctctctcgattggaatttttccatatgtt
ctcaagttgcttcaaagtcccgcccaggaattgaagcctgttctcatctttatttgggcc
cgaataatggcaattgaccacaagagcacccagcaggaactctgcaaggacaaaggatac
aactatttttacctcattttaaactccagtccggggaatctgaacggtccagtgggcgca
ccaggaggctattcgaacaccaatatcttgataaatgacgaccataaagccatgagtgct
ttcatcttaacgctattcatcaaagacttcaaaaatggtcagcggttatcgttctccgtt
gagcttattcacaattgtctaaagttcatttccacgagcgagaaccctttgttaagacaa
tggtgctgtttgcttttatctcagctctggaacaactatcccgatggaaaatggatcaac
tataaagatggctaccttaacaaattgcttttgatggttaatgatcctattcctgaggtt
cgtacgtctgtcattctcgccttgaccacgttcttgagcgacgtagacggcgagtctctg
ccacaaggaagcatgaatgctgctttgcggaaagacgaattgaagcagcaagatcttaag
ctcgccaacaccattttaggactacttggagacggctctccaatggtacgcaaggagatc
attttcttcattcgcaagtttatcaacatctactcaaagttctttttggttgtgtctttc
aatcagcttgaagaagaaattgtgttgatcgacaaccccaatgaacttaatgagttccgg
aaaaagtctccagcatacggtctgattttctcgtcgatctggaaagcgttgctcattctt
actgaggacccccatcctgaaatcaagcagctagcagagattctcgtggatcaaatcatg
ctccagttgaacaaaagtgagcttggccaattggtccgtgaaatggaagagtatttgttg
agcaaatccacccttaatatgagccaaacttttggacaaggtgcaccttcgaaacccata
attaatcgccaattgaatggtgacggaagacgtcaagtttccagcggatcaaccctccag
cgcaacagcagcatgcaaagaaacaataatgttctcaagatcacttccagacctcgatct
gtgtccaccaacaacatggaagactccaaccattccgactccgactctgtatcttctaag
ctcaaaaacttttcaatagccaaattgttcaagtcgcttcatatttctgaggaaactgac
ctcaagaacttttccaggatgttgagttcaggacccatcaccagcaattatggagcagag
tacaagcccaagagcgctcgtttcaagcccagagacttgacgaaggagcccaagcttcct
gacgagtccggattcttccagtacagctgtgagtatttccaggagccgcaaatgtccaaa
aatgaaatcgacgagcctgggtctgaagagtacgtgaagcgcatttggcgcagaaacaga
aacgagtctatcatccaggaaacccaaccgcaaaagacaatggcattgcgtggagattgg
aacaaaaatatccgagtgatgaacaacaagagccagcctcggttaatcaaattcacccag
ttcgaaaagctcttggttgcctgtgatgacaaggacaatatgtcggtgtgggactgggaa
gactgtaagctggtgaagaagttttccaatgaaaatccttttggaaccaaaatcaccgat
atcaagtttctcaacgaggacgatcttccgctcgttctcaccggttcttctgatggagtg
gtgaagatatacaaaaatttccacctcgaggatgaacagatcgagttggtggcttcatgg
cgagcattgacagaccttcttttgacgtcgaaaagcacaggacttgtttcggactggcag
caatctcgagggtcgttgctcgttagtggagatgtgaaaatcattcgggtttgggatgcg
ccccgtgagctttgcctagcggatattcctgctcgttcgtcgtcttccatcacctcgttg
acctcggaccaagtcacaggaaacttatttgttgctgggttcgacgacggttcggtgaga
gtttacgaccgaagattggattcgcgagagtcgatggtgagggtgtggaacggagccaag
gcacaacccggtgtttcttctcgccgcaggtatggccatggaagtatcaggaacaccaga
atgcaaagaggtggacttcgtgaattggtaacgggttcttccgatggatacgtgaatcta
tgggacatcagagaaagtgaaccagtgcttacttttaccaacgaacccgaaaagtctatg
cggtgcatcgacgttcatgaacatgctccagtgataactaccgggtccaaatctgtgagc
ctttggagcacttctggcgatatggtttctgtgttgaaaaatccacacgaatcgcttttg
accaatcgaaccgccagctatttgaccggcaccacgttccatcctcaccggatgatgttg
gcgacgaactataaccaggatggacatataaatgtgtactcgtgctcggacatcatacag
gagtattaa

DBGET integrated database retrieval system