KEGG   Meyerozyma guilliermondii: PGUG_05560Help
Entry
PGUG_05560        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGUG_05560
Enzymes [BR:pgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PGUG_05560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
MSSEVNRRILLLKNKTTPRDPYHDVFTDAGFEPTFIPLLKHGHVDREKSIEYFTGEEFLL
IPVFIITSQRAVECLNECLEHVSLEIKTVIHEKTVYTVGPATTEVLREAGFTNIKGGSDA
GNGSVLSDIIIKDVQEGGPSKMIFLTGEIRKDIIPRKLKQAKIDLIEKVIYKTEPRDDIV
SNFHSSSKDVRWVVFFSPQGTVPIVEHLQGAERSSAMGPFVASIGPTTEEYLQSYSIGID
AVASKPEAKSLLAAITAYEHQN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgaagtgaaccgaagaatattgctcctcaagaacaaaaccacccctcgagat
ccgtaccatgatgtgtttacagatgctgggttcgagcccaccttcatacctttgctcaaa
catggacatgttgaccgtgaaaaatcgatagagtactttacaggtgaagaattcttgctg
attccagtgtttataataacgagccagcgggcggtagagtgcttgaatgagtgcttagaa
catgttagtctggaaataaagaccgtcatacacgaaaagacagtttatactgtgggtcca
gctacaaccgaggtgcttcgagaagccggatttaccaatataaaaggtggttccgatgct
ggaaacggttcggtgttgtcagatatcataatcaaagatgtccaggaaggcggaccgtca
aagatgatatttcttactggagaaattagaaaagacatcatcccacggaaactcaagcaa
gccaagattgaccttattgagaaagtcatatacaaaactgaacctcgagacgacatagtt
agcaacttccactcgagcagcaaggatgttcgttgggtggtatttttcagtccgcaagga
accgttcccatagtagagcatttgcaaggtgctgaacgcagcagcgccatgggtcccttt
gtggcctcgattggacccaccaccgaggagtaccttcagagttatagcataggcattgac
gcagttgcatccaagcccgaagccaagtcgttgttggcagcaattacggcgtacgaacac
caaaactag

DBGET integrated database retrieval system