KEGG   Meyerozyma guilliermondii: PGUG_05616Help
Entry
PGUG_05616        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PGUG_05616
Protein kinases [BR:pgu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   PGUG_05616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MGTAWELTAALRDQIHRYASYRQTSVSLRQMVQFGPSPSPGLIFLASQFIVEELPIRLAL
KVKDLESAPFGLCDMPSTQKVKNWYAQSFEELTTLPKPEISPELAKLLNGNGGLDKSRVV
DDETNHEDKNFLKQTHNPANSEHVNPAINNVFSDDGIVVRQHSNPRSSSKLRLELPTFGK
MYYTSCPTNVVWPKEVYDYNKLVNDALTKIKKRHDATVATMAQGVQEWKHEHKTVSVNSQ
IQTFLDRFYMLRIGIRMLIGQHIALNMAQASPTKARINKVLNGNTSKSKSNYVGVICTDC
NVGEIAEDAIETAKYICEEYYGLFEAPEIQLIAPSNDISFMYVPGHLIHMLFETLKNSLR
ATIEFHMPRLKQELMLKDPELKEADIDINDLKFPPIKVIISEGSEDIAIKISDEGGGIAR
SEVPLIWTYLYTTVSKTPVLEPEYDQTSFKAPMAGFGYGLPISRLYAQYFGGDLKLILME
GYGTDVYLHLNRLSSSSEPLP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggtacggcttgggaactcacggcggctttgcgtgaccagatacatcggtatgcttca
taccgacagacgtcggtatcgttacggcaaatggtccaatttggaccaagtccatctcca
ggactgatttttcttgcttctcagttcatcgtggaggaattgcccattcgtttggcactt
aaagtcaaggatttggagtcggcgccatttggtctttgcgacatgccctctacacaaaag
gtgaagaattggtacgctcaatcttttgaagaactcactacgcttcccaaacccgagatt
tcgccagagttagccaagttgttgaatgggaatggaggattggacaaaagtagagtggtg
gatgacgaaacaaaccacgaagataaaaactttctcaaacaaacccacaatcctgcaaac
agcgaacatgtcaatccggccataaacaacgttttcagtgacgacggtatcgttgtaaga
cagcattctaaccccaggtcatcgtccaaactgcgactggagctgcctacatttggaaaa
atgtactacacttcatgtcccaccaatgtagtgtggcccaaagaagtttacgattacaac
aaattggtcaacgatgcgctcaccaaaatcaaaaagcgtcatgatgctacagtggctacc
atggctcaaggtgtacaagaatggaaacacgaacacaagacagtttctgtcaattcgcaa
atccaaacttttttggaccgattttacatgctgaggattggtattagaatgttaattgga
caacatatcgccctcaatatggcacaagcgtcacccacaaaggcccgtattaacaaggta
cttaacgggaacacctccaagtccaaatccaactatgtgggtgtgatttgcaccgattgc
aatgtcggtgaaattgcggaagatgcaattgaaacagccaaatatatctgtgaagaatac
tatgggctctttgaagcgccggaaatccaactcattgcccccagcaacgatatctccttc
atgtacgttccgggccacttgattcatatgttatttgaaacactcaagaattcgcttcgt
gcaaccattgagttccatatgccaagactcaagcaggaattgatgctgaaagaccctgag
cttaaggaggcagatatcgatatcaatgatctcaagtttccacccatcaaagtgattatt
tctgagggaagtgaagatattgctatcaagatcagcgacgaaggaggaggaattgctcgc
agcgaagtgccattaatttggacttatttgtatactacagtgagcaagactcccgtgttg
gaaccagagtacgatcagacttcattcaaggctccaatggccggttttggttatggattg
ccaatatctcggttgtacgctcagtactttggaggtgacttaaagttgattctgatggag
ggttatggaaccgatgtgtatttgcatttgaaccgattaagcagcagcagcgagcctctt
ccatag

DBGET integrated database retrieval system