KEGG   Meyerozyma guilliermondii: PGUG_05623Help
Entry
PGUG_05623        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pgu00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MQKLALVIVDLQNDFLPPHGSLAVPGGNEIINNIINLLDPHKYRFLAVIATQDWHPSDHC
SFASQHGSEPYTSKVFEHPENKKDQHGKTITLNQTLWPDHCIQNTEGAELELEFEKVFNK
LEVPHTIIKKGYLKDREYYSCFGDCWDLHHTEINQYLKDNGITDVVFAGLAYDYCVLQSA
IDSVKKGYKTYVVKEACKNVYPQKMPLTDNIYRSHGITVTHVNDFFLTKFQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaactagctcttgttattgtcgatctccagaacgactttcttcctccacatggt
tcgttggctgtaccgggaggcaatgaaattatcaacaacatcatcaacttgttggatcct
cacaagtacaggtttctggcagttatagcaactcaggattggcatccttctgaccactgc
tcatttgcttctcaacatggttcggagccctacacatccaaggtgtttgagcatccagaa
aacaagaaagatcaacatggaaaaaccatcaccttgaaccagacgctctggccggatcat
tgtattcagaatacagaaggagctgagctcgagctggagtttgagaaggttttcaacaag
ctagaggtgccacataccatcatcaaaaaaggataccttaaagaccgagaatactattcc
tgttttggtgattgctgggacctccatcatactgaaatcaaccaatacttgaaagataat
ggcataactgatgttgtattcgcagggcttgcgtacgattactgtgtcctccagtctgcc
atagatagcgtcaagaaaggatacaaaacatatgtggtgaaagaggcttgtaaaaatgta
tacccgcaaaaaatgcctttaacagataacatttaccggtcccacggcatcaccgttaca
catgtgaacgactttttccttacaaagtttcagtga

DBGET integrated database retrieval system