KEGG   Meyerozyma guilliermondii: PGUG_05660Help
Entry
PGUG_05660        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGUG_05660
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PGUG_05660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 404 aa AA seqDB search
MKLLPLLFATALAQLTLKNDNVVYDSNPPSLSEMWDGLWPFQGINTFAHLDHKVCLTQPD
EIYDFAIIGVPFDTAVLYRPGARFGPRAIRAAAQRQTSLRGYNQRANFNPYTSWAKVLDC
GDIPVTPMDNHLAFKQMDLAFEELILRRNSSSKAPPRYIALGGDHSVLLPHLRALKKAYG
PLNVIHFDAHLDTWSPDKYPSFWHSDQSEITHGSMLWTAFEEGLTTNTNIHAGLRTKLSG
LEDYEDDDKQNFVRIYADDIWIDGVQSVIAKINATIPADTPTYISVDIDVLDPGFGSGTG
TQEPGGWLPRELIYVLRHIDHLTIVGGDVVEVSPAFDNAEITATNGAQVAYELLTSMVKK
GRVDLLVQREEATPIIKSSEVELTLEERLTSEIRQLKNMQALFN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccttcctcttctttttgccactgctttggctcaattgaccctaaaaaacgac
aatgtggtgtacgattccaacccaccttccctctcggagatgtgggatggactctggcca
ttccagggtatcaatacttttgcccatttggaccataaagtttgtttgactcaacccgat
gaaatttacgattttgccataattggtgttccattcgatacggcagtgctgtatcgccca
ggagccagattcggtcccagggccattcgggctgctgctcagcgccaaacctctcttcgt
ggctacaatcaacgagccaatttcaatccttatacttcatgggccaaagtacttgattgt
ggagatattccagttacacccatggataaccaccttgcattcaagcagatggacctagca
ttcgaagagttgattctccgtcgaaactcgagctccaaagctccccctcgttacatagct
ttgggaggagatcactctgtgctcttgccacatttaagagcacttaaaaaggcatatggt
cctcttaatgtgatccactttgatgcccaccttgatacgtggtcgccagacaagtatcct
tcgttctggcattcggaccagtcggaaataacccatggttccatgctctggactgcgttc
gaagaaggtctcaccaccaacacaaacatccatgctggattgcggaccaaactttccgga
cttgaagactacgaggacgacgacaagcagaactttgtcaggatctacgcagacgacatt
tggattgacggggtccagtcggttatcgccaaaatcaatgccaccattccggccgatact
cccacctatatatctgttgatatcgatgtgcttgatccaggatttggtagtggtaccggt
acccaggagcctggcggatggttaccccgtgagctcatctatgtgttgagacacatcgac
catcttaccatagttggcggagatgtggttgaggtttctccagcttttgataatgctgaa
ataactgctaccaatggcgctcaagtagcgtacgagctcttgacgtccatggtcaagaaa
ggaagagtggatctgctcgtgcagagagaagaagctacaccaatcatcaagtcgtccgag
gtggaactaactcttgaagaacgtctcacttcggaaatcagacaactcaagaacatgcaa
gcattgtttaactag

DBGET integrated database retrieval system