KEGG   Meyerozyma guilliermondii: PGUG_05718Help
Entry
PGUG_05718        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pgu  Meyerozyma guilliermondii
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:pgu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 207 aa AA seqDB search
MSEELSKQTESLSLDKETVLTNKSEFTAKHPLNNKWTLWYTKPQVNKSENWHDLLKPVIT
FSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIKPEWEDEQNAKGGKWQYSFSNKIGPAI
NDLWLRGLLSVIGETIEDEEDEVNGIVLNVRRQAIRIGVWTKDCDNAKLRTVGERLKKVL
KLSDDQKIDFMSHDDSGKKGAEPQLVL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagaattaagtaaacagacagaatcgttgtcgttggacaaggaaaccgtattg
actaacaagtcggagttcaccgccaagcaccccttgaacaacaagtggactttatggtac
acaaagccccaggtcaacaaaagtgaaaactggcacgatttgttgaaacccgtcatcaca
ttttcgtccgtagaagagttctggggcatctataattcgattcctccagctaaccagctc
cccttgaagtccgattaccatttgtttaaggagggaatcaagcctgaatgggaagatgaa
caaaatgccaaaggaggaaaatggcaatattcattttctaacaagattggaccagctatc
aatgatttgtggttgcgtggattattgtcggtgattggtgagaccattgaagatgaagaa
gacgaagtaaatggaattgttttgaacgtaagaagacaagcaatcagaattggagtgtgg
accaaagactgtgacaatgccaagttacgaacggttggcgagcggttgaagaaggttttg
aagttgtcagacgaccagaagatcgatttcatgtcgcacgacgattctggaaagaagggg
gccgagcctcagttagtgttgtag

DBGET integrated database retrieval system