KEGG   Meyerozyma guilliermondii: PGUG_05744Help
Entry
PGUG_05744        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pgu  Meyerozyma guilliermondii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGUG_05744
Messenger RNA biogenesis [BR:pgu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PGUG_05744
Translation factors [BR:pgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PGUG_05744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 738 aa AA seqDB search
MCGCVGVISNVDENFQVKTIVTMSDIDYEALEKEVPLDDIDFSDLEEQYAVKPDFGIDNF
VVVDGAPIAPEAKVPVLIKVLKKLFSTVGEIVEGEEGIHMPLEDGKSKGFLFIQFKTAQM
ADAAIQQMHGKKLDQKHRLLVNKLSDIEKYGIEGNVPTEFKEPEIPPFKSHGYLKSWLQD
EQGRDQIGLHYSDTFGVYWNKRKSPEPVIEPRKGFTSKYAKFSPKGTYLFSIHPQGIQSW
GGAQFESISKFIHSQVRLIDFSPNEKYLVTLSPQPIQVPENPAERALYPFGPESNGHKLV
IWDLATSEPARTFALPPHLEGQKEMPWPLVKWSHDDKYCARQGPGALAIYETPSFQLLDK
KLVKIDDIVDFEWAPAPVYLDTSSQNGPGEHVLSYWTPESSNQTARVALMQIPSRQVLRT
INLFQVSDCKMHWQDEAKYLCVKVDRHTKSGKTIFSNLEFFKVTERDIPVEKLELKEVVI
NFAWEPRSDRFVTISRLDDGALNPAIPKNTIAFYAPETSKTKGGAITSSKYKAFETVVDK
HSNTVYWSPKGRFVVIATLARSNGELEFYDCTYEEENVRTTSKNNVKLLKSEKFSGMTNL
AWDPSGRFVAAWSSSWIHTIENGYKMFEFTGNMLRDESIDNFNEFLWRPRPPSMLNAADR
KKVRKNLRTYSAQFEEADAMEADAATRQLILTRRKQLEEWRAYRAKHASAGHQKKEDKMT
VIEEIKEEIIEEKEEIVE
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggtgtgtgggtgtgatttcaaatgttgatgaaaattttcaagtgaaaactatt
gtaaccatgagtgacatcgactacgaagcactcgaaaaagaggttccgttggacgatatt
gacttttccgacttggaagagcaatatgctgtcaagccagactttggaattgacaatttt
gtcgttgttgatggtgcgccaatcgcgcccgaagccaaggtaccagtgttgatcaaggtt
ttgaaaaagcttttcagtacagttggagaaattgtagagggagaagaagggattcacatg
ccattagaagatggaaagtcgaagggattcttgtttattcagttcaaaactgcccaaatg
gccgatgcggccatccaacaaatgcatggaaaaaaattggatcagaagcacagattgctt
gttaacaaattgagtgatattgagaaatacggcattgaaggaaacgtgcctactgagttc
aaagaacctgaaattcctcctttcaaaagtcacggttatctcaaatcgtggttgcaggat
gaacagggccgtgatcagattggcttacattattctgatacttttggtgtctactggaac
aagagaaagtctccagaaccagtcattgaaccaagaaagggtttcacctccaaatatgcc
aaattttctccaaagggtacctaccttttctccatccatccccagggtatccagtcatgg
ggtggtgctcagtttgaaagtatcagcaaatttattcactcccaagtgaggttgattgac
ttttctcctaatgaaaaatacttggtgaccttgtcgcctcagccaattcaggttcctgaa
aatccagccgagagagccctgtacccctttggaccagaaagcaatggtcacaaattggtt
atttgggatttggctactagtgaacctgccagaacctttgccttacctcctcatttggaa
ggtcaaaaggaaatgccatggccattggtgaaatggtcacacgacgacaagtactgtgct
cgtcaaggaccgggtgcattagccatctatgagactcctagcttccagcttttggacaaa
aagttggtcaagattgacgacattgttgattttgagtgggctccagctcctgtctatctt
gacaccagcagccaaaatggtcctggagagcatgtcttgtcgtattggactccagaaagt
tctaaccaaaccgccagagttgctttaatgcaaatacctagcagacaagttcttcgtacc
atcaacttgttccaagtcagtgactgtaagatgcactggcaagatgaagctaaatatttg
tgtgtgaaggttgatcgtcataccaagtctggaaagaccatattctccaatttggagttc
tttaaagttaccgagagagatattcctgtggaaaaattggagttgaaagaagtggttatt
aattttgcatgggaaccaagatccgatagattcgtcactatttctagattggacgacggt
gcactcaatcctgctatccccaaaaacaccattgcgttctacgctccagaaacttccaag
acaaagggaggtgccatcacctcatccaaatacaaggcattcgagactgttgttgataag
cattccaatacagtgtactggtcgcccaagggaagatttgtggtcattgcaactttggca
agatctaatggagaattggagttttatgactgcacttatgaggaagaaaatgttaggact
acatctaagaacaacgtcaagttgttgaagtctgagaagttttctggtatgaccaacctc
gcctgggatccttcaggaagatttgtggctgcatggtcatcttcatggatccacaccatc
gaaaacggttacaagatgttcgaatttaccggtaatatgttgagagatgagtcaatcgac
aactttaacgaattcttgtggagaccaagacctccttcgatgttgaatgctgctgataga
aagaaggtgagaaagaacttgcgtacttatagtgctcaattcgaagaagccgatgctatg
gaggccgatgctgccaccagacaactcattttgacgagaagaaagcaattagaagaatgg
agagcttacagagccaagcatgcctctgcaggacaccaaaagaaggaagacaagatgact
gttatcgaggaaatcaaagaggagatcatcgaggagaaggaggaaatcgtggagtaa

DBGET integrated database retrieval system