KEGG   Meyerozyma guilliermondii: PGUG_05817Help
Entry
PGUG_05817        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PGUG_05817
Enzymes [BR:pgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PGUG_05817
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PGUG_05817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 238 aa AA seqDB search
MSYVPTLKALVKKLETHTRARGNPKEVLAILDTLVQENGGMMNIGPEKGNIIKEILRKNP
PKTMIELGCFFGYSAVMFAGELQKVDGAKYTSFELSEDFAAISRRVVDFAGLSNKVDIVV
GPASKTLPEFWERLKRQVDFAFIDHEKRAYVPDLQIMESLGLVAPGTILVADNVIRPGAP
EYIKYVEASTDERKKLLNVGSQYPGKWNLLYDSNQIKVLLGFGVDALEVSKCVGVAEE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatgtccctactttgaaagccctcgtgaagaaacttgagactcatacccgagca
aggggtaatcccaaggaagtccttgctattcttgacactttagttcaagagaatggaggc
atgatgaacataggtcctgaaaaaggaaacataatcaaagaaattctccggaaaaaccct
cctaaaaccatgatagagcttggatgtttctttgggtactctgctgtgatgtttgctggc
gaattgcaaaaggtggatggtgccaagtacaccagttttgaattgagtgaggattttgca
gccatttctcgtcgtgtggtagactttgctggattgtctaacaaggtggacattgtggtg
ggacctgcctccaaaacacttcctgaattttgggaaaggctgaaaagacaggtggacttt
gctttcatcgaccacgaaaagagggcctatgtgcccgatttgcagatcatggaatcactc
ggacttgtagctccaggaaccattcttgttgcagacaatgtcattcgcccaggggctccg
gagtacatcaagtacgtcgaggcttctaccgatgagcgtaaaaagttgttgaatgtgggc
tctcagtaccctggaaaatggaacctactttacgactccaaccagataaaggttctgctg
ggcttcggtgtagatgctttggaggtttctaagtgcgtgggagtcgccgaagagtaa

DBGET integrated database retrieval system