KEGG   Polymorphum gilvum: SL003B_0050Help
Entry
SL003B_0050       CDS       T01458                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pgv  Polymorphum gilvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgv01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pgv00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pgv00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(54402..55238)
Genome map
AA seq 278 aa AA seqDB search
MTETRIDRRFKACADKGRPALVTFITAGDPDLETSQAVLDALPAAGADVIELGMPFSDPM
AEGIPIQRANQRALAAGQTMNKTLQMVRAFRRKDQDTPIVLMGYYNPIYVRDPVRFVAEA
RDAGVDGLIVVDIPPEADDELCLPALEAGLNFIRLATPTTDDKRLPTVLANTSGFVYYVS
ITGITGAAAPDAGKVAAAVGRIKGHTDLPVAVGFGVRTADQAAEIGRNADGVVVGSVLVE
AIRASLDDAGKATDKTVSAVVDLVSALAGGVARARAAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacgcgtatcgaccgccgattcaaggcctgtgccgacaagggccggccggcc
ctggtgaccttcatcaccgccggcgatccggacctcgaaacctcccaggcggttctcgac
gcgctgcccgcggccggcgccgatgtcatcgagctcggcatgcccttctccgaccccatg
gccgaaggcatcccgatccagcgcgccaaccagcgcgccctggccgccggccagaccatg
aacaagacgctgcagatggtccgcgccttccggcggaaggaccaggacacgccgatcgtg
ctgatgggctactacaatcctatctacgtgcgcgatccggtccgcttcgtcgccgaggcc
agggacgccggcgtcgacggcctgatcgtcgtcgacatcccgcccgaggcggacgacgag
ctctgccttcccgcgctggaggcgggcctcaacttcatccgcctggcgacgccgaccacc
gacgacaagcgcctgccgacggttttggccaacacctccggtttcgtctattatgtctcc
atcaccggcatcaccggcgcggccgcgccggacgccggcaaggtggcggcggcggtcgga
cgcatcaagggtcatacggatcttcccgtggcggtcggcttcggcgtcaggaccgccgac
caggcggccgagatcggccgcaacgccgatggcgtggtggtcggctcggtgctggtcgag
gcgatccgcgccagccttgatgatgccggaaaggcaacggataagacggtgtcggccgtg
gtcgatctcgtgtccgcgctggccggcggcgttgcccgcgcccgcgccgcgtcctga

DBGET integrated database retrieval system