KEGG   Polymorphum gilvum: SL003B_0050Help
Entry
SL003B_0050       CDS       T01458                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pgv  Polymorphum gilvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SL003B_0050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SL003B_0050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SL003B_0050
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SL003B_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(54402..55238)
Genome map
AA seq 278 aa AA seqDB search
MTETRIDRRFKACADKGRPALVTFITAGDPDLETSQAVLDALPAAGADVIELGMPFSDPM
AEGIPIQRANQRALAAGQTMNKTLQMVRAFRRKDQDTPIVLMGYYNPIYVRDPVRFVAEA
RDAGVDGLIVVDIPPEADDELCLPALEAGLNFIRLATPTTDDKRLPTVLANTSGFVYYVS
ITGITGAAAPDAGKVAAAVGRIKGHTDLPVAVGFGVRTADQAAEIGRNADGVVVGSVLVE
AIRASLDDAGKATDKTVSAVVDLVSALAGGVARARAAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacgcgtatcgaccgccgattcaaggcctgtgccgacaagggccggccggcc
ctggtgaccttcatcaccgccggcgatccggacctcgaaacctcccaggcggttctcgac
gcgctgcccgcggccggcgccgatgtcatcgagctcggcatgcccttctccgaccccatg
gccgaaggcatcccgatccagcgcgccaaccagcgcgccctggccgccggccagaccatg
aacaagacgctgcagatggtccgcgccttccggcggaaggaccaggacacgccgatcgtg
ctgatgggctactacaatcctatctacgtgcgcgatccggtccgcttcgtcgccgaggcc
agggacgccggcgtcgacggcctgatcgtcgtcgacatcccgcccgaggcggacgacgag
ctctgccttcccgcgctggaggcgggcctcaacttcatccgcctggcgacgccgaccacc
gacgacaagcgcctgccgacggttttggccaacacctccggtttcgtctattatgtctcc
atcaccggcatcaccggcgcggccgcgccggacgccggcaaggtggcggcggcggtcgga
cgcatcaagggtcatacggatcttcccgtggcggtcggcttcggcgtcaggaccgccgac
caggcggccgagatcggccgcaacgccgatggcgtggtggtcggctcggtgctggtcgag
gcgatccgcgccagccttgatgatgccggaaaggcaacggataagacggtgtcggccgtg
gtcgatctcgtgtccgcgctggccggcggcgttgcccgcgcccgcgccgcgtcctga

DBGET integrated database retrieval system