KEGG   Polymorphum gilvum: SL003B_0052Help
Entry
SL003B_0052       CDS       T01458                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pgv  Polymorphum gilvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SL003B_0052 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SL003B_0052 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SL003B_0052 (trpB)
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SL003B_0052 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(55812..57056)
Genome map
AA seq 414 aa AA seqDB search
MTTIANTLRSGPDARGHFGIYGGRYVAETLMPLILDLEQAYADAKADPAFRAELDDLNTH
YTGRPSPLYFAERLTEHLREVSEASGLGGGAKIYFKRDELNHTGSHKINNCLGQILLAKR
MGKTRIIAETGAGQHGVATATVCARFGLPCVVYMGATDVERQKPNVFRMKLLGAEIVPVT
AGAGTLKDAMNEALRDWVTNVDSTYYLIGTAAGPHPYPELVRDFQSVIGQEVREQMLAAE
GRLPDALVAAVGGGSNAIGLFHPFLDDASVAIYGVEAGGKGLDGHEHCASLNAGRPGVLH
GNRTYLLQDGDGQILEGHSISAGLDYPGIGPEHAWLKDTGRVTYVPATDDEALAAFQMLT
RVEGIIPALEPAHALAQVIKLAPTMDRDKIIVMNLCGRGDKDVFTVGKILGFDL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaccatcgcgaacaccctgcggtcgggtcccgacgcacgcggccatttcggcatc
tatggcggccgctacgtggccgagaccctgatgccgctgatcctcgacctcgagcaggcc
tatgccgacgccaaggccgatccggcgttccgcgccgagctggacgacctcaacacccat
tacaccggccggccctcgccgctctatttcgccgagcggctgacggagcatcttcgtgag
gtttctgaggcctccggcctcgggggcggcgcgaagatctacttcaagcgcgacgaactc
aaccacaccggcagccacaagatcaacaactgcctcggccagatcctcctggccaagcgc
atgggcaagacgcgcatcatcgccgagaccggcgccggacagcacggcgtcgccaccgcc
accgtctgcgcccgcttcggcctgccctgcgtggtctacatgggcgccaccgacgtcgag
cggcaaaagcccaacgtgttccgcatgaaactgctcggcgccgagatcgtgccggtcacc
gccggcgccggcacgctcaaggatgccatgaacgaggccctgcgcgactgggtcaccaac
gtcgacagcacctattatctcatcggcaccgccgccggcccgcacccctatccggaactg
gtgcgcgacttccagtcggtcatcggccaggaggtgcgcgagcagatgctggcggccgag
ggccgcctgccggatgcgctggtcgccgccgtcggcggcggctccaacgccatcggcctg
ttccatcccttcctcgacgacgcctcggtggcgatctacggcgtcgaggccggcggcaag
ggtctcgacggccacgagcactgcgcctcgctcaacgccggccggcccggcgtgctgcac
ggcaaccgcacctacctgctgcaggacggcgacggccagatcctcgagggccactcgatc
tcagccggcctcgactatcccggcatcggcccggagcatgcctggctgaaggacaccggc
cgcgtcacctacgtgccggcgaccgacgacgaggcgctcgccgccttccagatgctgacc
cgcgtcgagggcatcatcccggcgctggagccggcccatgcgctcgcccaggtcatcaag
ctggcgccgaccatggacagggacaagatcatcgtcatgaacctgtgcggtcgcggcgac
aaggacgtcttcaccgtcggcaagatcctcggcttcgatctctga

DBGET integrated database retrieval system