KEGG   Polymorphum gilvum: SL003B_0169Help
Entry
SL003B_0169       CDS       T01458                                 

Definition
(GenBank) Putative acetyl-coenzyme A synthetase (AcsA-like)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00010  Glycolysis / Gluconeogenesis
pgv00620  Pyruvate metabolism
pgv00640  Propanoate metabolism
pgv00680  Methane metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_0169
   00620 Pyruvate metabolism
    SL003B_0169
   00640 Propanoate metabolism
    SL003B_0169
  Energy metabolism
   00680 Methane metabolism
    SL003B_0169
Enzymes [BR:pgv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SL003B_0169
Lipid biosynthesis proteins [BR:pgv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SL003B_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADZ68608
UniProt: F2J073
Position
complement(176631..178271)
Genome map
AA seq 546 aa AA seqDB search
MLEQAADYETLRAGFRWAIPERYNIAAAVCDDWAARAPERAAIVHVQTDDSVRTWSYLEL
ARASSRFANALAARGIGRGDRVALLLPQAPETAIAHLAIYRLGAIAVPLAALFGVEALTY
RLTDSGARAIVTNAAGLEKLAGLRGRLPDLRLVVSIDGAGAGAEGFETLLGRASDRFETV
ATTPDDPALMIYTSGTTGQPKGVLHGHRVLLGHMPGIEMSQDFLGQAGDILWTPADWAWA
GGLLNALFPALLLGVPVIAHAVHKFDPEHAFRLIARQGVRNAFIPPTALKMLRQVDRPAA
RFDLKLRSIGSAGEALGREAYDWVRSELGLVVNEFYGQTECNAVLGSCAALGVSRAGAIG
KPIPGHEVAVIDEAGAVLPPETLGQIAVRRPDPVMFLEYWNRPEATAEKFVGDWMTTGDQ
GMTDADGYVRFVGRDDDVITSASYRIGPGEIEDCLLTHPAVALSAAVGKPDPLRTEIVKA
YIVLNKGYTPGPALEEEIRDYVRTRLSAHEYPREIAFIDDLPMTTTGKVVRRELRERARD
ETDRGG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagcaggctgcggattacgagaccctgcgcgccggcttccgctgggcgatcccc
gagcgctacaacatcgccgccgccgtgtgcgacgattgggcggcgcgcgcgcccgagcgg
gcggcgatcgtccacgtccagaccgacgactcggtgcgcacctggagctaccttgagctt
gcgcgcgcctccagccgcttcgccaatgcgctggccgcacgcggcatcggccgcggcgac
cgcgtcgccctgctcctgccgcaggcgccggagacggcgatcgcgcatctggcgatctac
aggctcggcgccatcgccgtaccgctcgccgccctgttcggcgtcgaggcgctgacctac
cggctgaccgattccggcgcgcgggcgatcgtcaccaacgccgccgggctggaaaagctc
gccggcctgcgcggccgtctgccggatctgcggctggtcgtgtcgatcgacggcgctggg
gcgggagcggagggattcgagacactcttgggacgggcgtcggacaggttcgagacagtc
gcgacgacgccggacgatccggccctgatgatctacacctcgggcaccaccggccagccg
aagggcgtcctgcacggccatcgggtgctcctgggccacatgccgggcatcgagatgtcg
caggacttcctgggacaggctggggatatcctgtggacgccggcggactgggcctgggcg
gggggcctgctcaacgcgctgtttcccgccctcctcctcggcgtgccggtgatcgcccac
gcggtgcacaagttcgatccggagcacgccttccgcctgatcgcgcgccagggcgtgcgc
aacgccttcatcccgccgacggcactaaagatgctgcgccaggtcgaccgtcccgcggcg
cgtttcgacctcaagctgcgcagcatcggctcggccggcgaggcgctggggcgcgaggcc
tatgactgggtgcggtcggaattgggccttgtcgtcaacgagttctacggccagacggaa
tgcaacgcagtgctcggctcgtgcgcggccctcggcgtctcgcgcgccggcgcgatcggc
aagccgatccccggccacgaggtcgcagtgatcgacgaagccggcgccgtgctgccgccg
gaaacactcggccagatcgcggtgcgccggcccgacccggtgatgttcctggaatactgg
aacaggccggaggcgacggcagagaaattcgtcggcgactggatgaccaccggtgaccag
ggcatgaccgacgccgacggctacgtgcgcttcgtcggccgcgacgacgacgtcatcacc
tcggcgagctatcgtatcggcccgggcgagattgaggactgcctgctgacccatcccgcc
gtcgcgctgtcggccgccgtcggcaagcccgacccgctcaggaccgagatcgtcaaggcc
tatatcgtgctcaacaagggctatacccccgggccggcgctggaggaagagatccgcgac
tacgtgcgcacgcgcctgtcggcgcacgaatacccccgcgagatcgccttcatcgacgac
ctgccgatgaccaccacgggcaaggtcgtccgccgggagctgcgcgagcgggcgcgcgac
gagaccgatcgcggcggctga

DBGET integrated database retrieval system