KEGG   Polymorphum gilvum: SL003B_0186Help
Entry
SL003B_0186       CDS       T01458                                 

Definition
Succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pgv  Polymorphum gilvum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_0186
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL003B_0186
   00650 Butanoate metabolism
    SL003B_0186
  Energy metabolism
   00190 Oxidative phosphorylation
    SL003B_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(196130..196513)
Genome map
AA seq 127 aa AA seqDB search
MTDMRTPLAKVRGLGSAKDGTEHFWRQRVTAVANVFLISFFVITLISLQGAGYDEVRTCL
GNPIVAILMLLVIASGVYHMKLGMQVIIEDYVHGDGVKFLALMANTFFCAFIGLGSVFAV
LKLGFGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatgcgcacccccctcgccaaggtccgcggcctcggctcggccaaggacggc
acagagcacttctggcgccagcgcgtcaccgccgtggccaatgtgttcctgatctccttc
ttcgtcatcacgctgatctccctgcagggcgccggctacgacgaggttcggacctgcctc
ggcaacccgatcgtcgcgatcctgatgctgctggtgatcgcctcgggcgtctatcacatg
aagctcggcatgcaggtgatcatcgaggactacgtccacggcgacggcgtcaagttcctg
gccctgatggccaataccttcttctgcgccttcatcggcctcggctcggtgttcgcagtg
ctcaagctcggcttcggaggctga

DBGET integrated database retrieval system