KEGG   Polymorphum gilvum: SL003B_0186Help
Entry
SL003B_0186       CDS       T01458                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pgv  Polymorphum gilvum
Pathway
pgv00020  Citrate cycle (TCA cycle)
pgv00190  Oxidative phosphorylation
pgv00650  Butanoate metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
Module
pgv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pgv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL003B_0186
   00650 Butanoate metabolism
    SL003B_0186
  Energy metabolism
   00190 Oxidative phosphorylation
    SL003B_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ADZ68625
UniProt: F2J090
Position
complement(196130..196513)
Genome map
AA seq 127 aa AA seqDB search
MTDMRTPLAKVRGLGSAKDGTEHFWRQRVTAVANVFLISFFVITLISLQGAGYDEVRTCL
GNPIVAILMLLVIASGVYHMKLGMQVIIEDYVHGDGVKFLALMANTFFCAFIGLGSVFAV
LKLGFGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatgcgcacccccctcgccaaggtccgcggcctcggctcggccaaggacggc
acagagcacttctggcgccagcgcgtcaccgccgtggccaatgtgttcctgatctccttc
ttcgtcatcacgctgatctccctgcagggcgccggctacgacgaggttcggacctgcctc
ggcaacccgatcgtcgcgatcctgatgctgctggtgatcgcctcgggcgtctatcacatg
aagctcggcatgcaggtgatcatcgaggactacgtccacggcgacggcgtcaagttcctg
gccctgatggccaataccttcttctgcgccttcatcggcctcggctcggtgttcgcagtg
ctcaagctcggcttcggaggctga

DBGET integrated database retrieval system