KEGG   Polymorphum gilvum: SL003B_0189Help
Entry
SL003B_0189       CDS       T01458                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pgv  Polymorphum gilvum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SL003B_0189 (recR)
DNA repair and recombination proteins [BR:pgv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SL003B_0189 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(198001..198609)
Genome map
AA seq 202 aa AA seqDB search
MSNRRVAGPEIERLIQLLAKLPGLGPRSARRAALHLIKKKEQLLVPLAEAMGVAVERVGI
CSTCGTVDTSDPCTICADPGRDDSVLVVVEDVSDLWALERAAVLNARYHVLGGTLSPLDG
IGPEDLSIAALVERVRAGTIREVILAVNATVEGQTTAHYVTGQLAGLDVTVTRLAHGVPV
GGELDYLDEGTLAQALKARTRF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccgcagggtggccggaccggagatcgaacggctgatccagctcctggcgaaa
ctgccggggctcggaccgcgctcggcgcgccgcgccgcgctgcatctgatcaagaagaag
gagcagctgctggtgccgctggccgaggccatgggtgtcgctgtcgagagggtcggcatc
tgctcgacctgcggcacggtcgacacctccgacccctgcaccatctgcgccgatccgggc
cgcgacgacagcgttctggtcgtcgtcgaggacgtctcggacctgtgggcgctggagcgc
gccgccgtgctcaacgcccgctaccacgtgctcggcggcacgctgtcgccgctcgacggc
atcggcccggaggatctctccatcgccgcgctggtcgagcgggtgcgcgccggcacgatc
cgcgaggtcatcctcgccgtcaacgccacggtcgaaggccagaccacggcgcattacgtc
accggccagctcgccgggctcgacgttaccgtcacccggctcgcccacggcgtgccggtc
ggcggcgagctcgactatctcgacgagggcacgctggcccaggcgctcaaggcccgcacg
cggttctga

DBGET integrated database retrieval system