KEGG   Polymorphum gilvum: SL003B_0223Help
Entry
SL003B_0223       CDS       T01458                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pgv  Polymorphum gilvum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SL003B_0223
Enzymes [BR:pgv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SL003B_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230403..231170
Genome map
AA seq 255 aa AA seqDB search
MGILNLTPDSFSDGGRFVDARTAVAHARAMAEEGADILDIGGESTRPGAAPVSLEEEWAR
LAPVLDPVVELGLPVSIDTYKAEIARRACAAGAVIVNDVWGLQRDSAMADAVAETGAHVI
MMHNRTKADPSVDILADIDRFFERSMTLADRAGIARDRQILDPGFGFGKTVDQNYLILNR
FASLKKHGLPLLAGASRKRMIAAVLDVLADERLYGSLAVHLLAAERGAAIVRVHDVRPHV
DALRILEATLAEQVR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcctcaacctaacgccggacagcttttccgacggcgggcgttttgtcgacgcc
cgaacggccgtcgcccatgcgcgggcgatggcggaggagggcgccgacatcctcgacatc
ggcggcgaaagcacccgtccgggcgccgctcccgtctcgctcgaggaggaatgggcgcgc
cttgctccggtgctcgatccggtggtcgagctcggcctgcccgtctccatcgacacctac
aaggccgagatcgcccggcgcgcctgcgccgccggcgcagtcatcgtcaacgacgtctgg
ggcctgcagagggactcggccatggccgacgcggtcgccgagaccggcgcccacgtgatc
atgatgcacaaccgtaccaaagccgacccgtcggtcgacatcctcgccgacatcgaccgc
ttcttcgaacgctcgatgaccctggcggatcgtgccggcatcgcgcgcgaccggcagatc
ctcgatccaggcttcggcttcggcaagaccgtcgaccagaactacctgatcctcaaccgc
ttcgcgtcgctgaagaagcacggcctgccgctgctcgccggcgcctcgcgcaagcgcatg
atcgccgcggtgctggacgtgctggccgacgagcgcctctacggctcgctcgccgtccac
ctgctggccgccgagcggggggcggcgattgtgcgcgtccacgacgtgcgaccccatgtc
gacgccttgcgcatcctggaagcgacccttgcggagcaggtccggtga

DBGET integrated database retrieval system