KEGG   Polymorphum gilvum: SL003B_0376Help
Entry
SL003B_0376       CDS       T01458                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00860  Porphyrin and chlorophyll metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SL003B_0376
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SL003B_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 RES Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ADZ68811
UniProt: F2J252
Position
372656..373357
Genome map
AA seq 233 aa AA seqDB search
MRFLVTRPQPDCARTAQRLRALGHEAVEAPLLAIVETPPESFDLSGVGALAVTSGRALAV
LAGHRQQDVLVGLPLYAVGDRTAERARALGFATVIAAGGDVAALAERIAADGVRQTVLYP
AARERAGDLEGLLAARGVACRTVEVYRSEPVDALPDAVAAALAAEAFDAVLVYSARTAGA
LAALLARAGPAARRPRVVAISAAAGAPLDALADVEAADRPDEAALIARALSAC
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcctggtcacccgaccccagcccgactgcgcccgcacggcacagcggctgcgg
gcgctgggccacgaggcggtcgaggcgccgctgctcgccatcgtcgagacgccgcccgaa
agcttcgacctctccggcgtcggcgcgctggcggtaaccagcgggcgtgccctggccgtc
ctcgccggccatcgccagcaggacgtcctcgtcggcctgccgctctacgccgtcggcgat
cgcaccgcggaacgcgccagggcgctcggctttgccacggtgatcgcggccggcggtgac
gtcgccgccctggcggaacgcatcgccgccgatggcgttcgacagacggtgctctatccc
gctgcgcgcgagcgggccggcgatctggaaggcctgctcgccgcccgcggcgtcgcctgc
cggacggtcgaggtctaccgcagcgaaccggtcgacgcgctgcccgacgccgtcgcggcc
gcgctcgccgccgaggccttcgacgcggtgctggtctattccgcgcgcaccgccggggca
ctggccgcgctcctggcacgggccggtccggccgctcgaaggccgcgcgtggtggcgatc
tccgcggcggccggcgcaccgctcgacgccctggccgatgtcgaggctgcggaccggccc
gacgaggcggcgctgatcgcgcgggccttaagcgcctgttaa

DBGET integrated database retrieval system