KEGG   Polymorphum gilvum: SL003B_0383Help
Entry
SL003B_0383       CDS       T01458                                 

Gene name
acs
Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pgv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgv00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pgv00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pgv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(381861..383498)
Genome map
AA seq 545 aa AA seqDB search
MLPDASNYADLRARFRWDVPETFNIAVAVCDRWAEAEPAREALVFAEENGPVRSYSYGEL
RALSNRLANLYVARGLKRGDRVGVLLPQSPETAVAHIAALKAGAISIPLFTLFGAEALEY
RLGDSGTGIVVTDRTGAARIATIRDRLPALETVLCTDGPAEGAEDLHALMADQPDLFRPV
ATRADDPALIIYTSGTTGQPKGALHAHRVLLGHLPGVEMSHDFLPQPGDRFWTPADWAWI
GGLLDVLMPALYHGIPVVACRFRKFTGEAAFQLLQDHKIRNAFLPPTALKMMRQVQAPET
RWTFSLRSVASGGETLGSELIDWGRKTFGLTINEFYGQTECNMIVSSCAAVMPARPGIMG
RPVPGHAVDVVDASGAVVPDETLGIIAVKRPDPVMFLGYWNNPAATAAKFAGDWLLTGDT
GMRDADGWIRFVGRDDDVITSSGYRIGPGEIEDCLLKHPAVALAGVIGKPDPQRTEIVKA
YVVLKDGVAASDALATEIAQFVRDRLAAHEYPREIAFVDALPMTTTGKVIRRELRRRAIE
ELQES
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgacgcgtccaactacgccgacctgcgggcgcgtttccgctgggacgtgccg
gagacgttcaacatcgccgtcgcggtctgcgaccgctgggccgaggccgagcctgcgcgc
gaggcgctggtgtttgccgaggaaaacggcccggttcgcagctatagctacggcgagctc
agggcgctgtcgaaccggctcgccaacctctacgtcgcccgcggcctcaagcgcggcgac
cgcgtcggcgtgctgctgccgcagagcccggagacggccgtcgcccacatcgcggcgctg
aaggccggcgcgatcagcatcccgctgttcaccctgttcggcgcggaggcgctggagtac
cggctcggcgattcaggcaccgggatcgtcgtcaccgaccgcaccggcgcggccaggatc
gcaacgatccgcgaccgcctaccagcgctcgaaacggtgctgtgcaccgacggtccggcg
gagggcgcggaagacctgcacgcgctgatggccgatcagccggacctcttccggccggtc
gccacccgcgccgacgatccggcactgatcatctacacctcgggcaccaccggccagccc
aagggcgccctgcacgcgcaccgcgtgctgctcggtcacctgccgggggtggagatgagc
cacgacttcctgccgcagcccggcgaccggttctggacgccggccgactgggcctggatc
ggcggcctgctcgacgtgctgatgccggcgctctaccacggcatcccggtcgtcgcctgc
cggttccgcaagttcaccggcgaggcggcgttccagctgctgcaggaccacaagatccgc
aacgccttcctgccgccgacggcgctgaagatgatgcgccaggtacaggccccggagacc
cgttggaccttctccctgaggtcagtcgcttccggcggcgagacgctcggcagcgagctg
atcgactggggccgcaagaccttcggcctgaccatcaacgagttctacggccagaccgag
tgcaacatgatcgtgtcgagctgcgcggcggtgatgccggcgcgacctggcatcatgggc
cggccggtgccgggccacgcggtcgacgtggtcgacgcctcgggcgccgtggtgcccgac
gagacgctcggcatcatcgcggtgaagcgacccgacccggtcatgttcctcggctactgg
aacaacccggcggcgacggcggcgaaattcgctggcgactggctgctgaccggcgacacc
ggcatgcgcgacgccgacggctggatccgcttcgtcggccgcgacgacgacgtcatcacc
tcgtccggctatcgcatcggcccgggcgagatcgaggactgcctgctgaagcacccggcg
gtcgcgctcgccggcgtgatcggcaagcccgacccgcagcgcaccgagatcgtcaaagcc
tatgtggtgctcaaggacggcgtggcggcgagcgacgcactcgccaccgagatcgcgcag
ttcgtcagggacaggcttgccgcgcacgagtatccgcgcgagatcgccttcgtcgacgcc
ctaccgatgaccaccaccggcaaagtgatccgccgggagctgcgccggcgcgcgatcgaa
gaactccaggagagctga

DBGET integrated database retrieval system