KEGG   Polymorphum gilvum: SL003B_0443Help
Entry
SL003B_0443       CDS       T01458                                 

Gene name
tesA
Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pgv  Polymorphum gilvum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pgv01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448555..449196
Genome map
AA seq 213 aa AA seqDB search
MQLKSYPFVVVGLIVLVVAGWGRAMAEPVKIVVLGDSLSAGYLLPPQEAFPVQLEQALKE
KGHDVTVVNAGVSGDTSSGGLSRLDWSVPEDTDAVILELGANDALRGLEPARTRENLDEI
VRRLKARGVEVLVAGMLAPRNLGEDYAAAFDPIFAEIAEAHGALLYPFFLDGVAMRPELN
LADGMHPTGEGVSVIVRNVLPSVEALISRVGAD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaaaatcgtatccgtttgtcgtcgtcggcctgattgtcctcgttgtcgccgga
tgggggcgcgccatggccgagccggtgaagatcgtcgtcctgggcgacagtctgtcggcc
ggctacctgctgccgccgcaggaagccttcccggtgcagctggaacaggcgctgaaggag
aagggccatgacgtcaccgtcgtcaatgcgggcgtgtccggcgacacctcgtccggcggc
ctgtcgcggctcgactggtcggtgccggaggacacggacgcggtgatcctggaactgggg
gcgaacgacgcgctgcgcggtctggagccggcgcggacgcgggagaacctcgacgagatc
gtccgccggctcaaggcacgcggcgtcgaggtcctggtcgcgggcatgctggcgccgcgc
aatctcggcgaggactacgccgccgccttcgatccgatcttcgccgagatcgccgaggcg
catggcgcgctgctgtatccgttcttcctggacggcgtggcgatgaggccggaactgaac
ctcgccgatggcatgcatccgaccggcgaaggcgtttccgtcatcgtgcgcaatgtgcta
ccgagcgtcgaagccctgatttccagggtcggcgcagactag

DBGET integrated database retrieval system