KEGG   Polymorphum gilvum: SL003B_0453Help
Entry
SL003B_0453       CDS       T01458                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_0453
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_0453
   00020 Citrate cycle (TCA cycle)
    SL003B_0453
   00620 Pyruvate metabolism
    SL003B_0453
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SL003B_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(459201..459989)
Genome map
AA seq 262 aa AA seqDB search
MTDLRPAAPAHLPFADQGTGGGSPVVLLHGFGGDRQTWSTIQAGLAPRRRSLAFDLPGHG
DALGWPRVGNAAVAAKAVVQSLDALGLGKVHLVGHSMGGAVAALIALRAPERLSSLTLLA
PGGFGPEINHKLLRRYAAASDEAELEMLLEQFFGWEFRLPRLLARHAAELRARPGACETL
QAIADEIIDGSVQKTLPRDELGSLGLPVKVVWGTQDRVLPTRQSHGLPGVVATHVFERVG
HMPHLEVPAEVIRLIAENAAAD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccttcgccccgccgcgcccgcccatctgcccttcgccgaccagggcacgggc
ggcggcagccccgtggtgctgctgcacggcttcggcggcgaccgccagacctggtcgacc
atccaggccggtctcgccccgcgccggcgctccctggccttcgacctgcccggccacggc
gacgcgctcggctggccgcgcgtcggcaacgccgccgtcgccgccaaggcggtcgtccag
tcgctcgatgccctcggcctcggcaaggtccacctggtcggccattccatgggcggcgcg
gtcgccgcgctgatcgcgctgcgcgctcccgagcgcctgtcgagcctcaccctgctcgcg
cccggcggtttcgggcccgagatcaaccacaagctcctgcgccgctacgccgccgcctcc
gacgaggccgaactcgaaatgctgctggaacagttcttcggctgggagttccgcctgccg
cggctgctcgcccgccacgccgccgagctgcgcgcgcgccccggcgcctgcgagaccctg
caggcgatcgccgacgagatcatcgacggcagcgtgcagaagaccctgccgcgcgacgag
ctcggcagtctcggcctgccggtcaaggtggtctggggcacccaggacagggtgctgccg
acccgccagtcgcacggcctgcccggcgtcgtcgccacccacgtcttcgagcgcgtcggc
cacatgccgcatctcgaggttccggccgaggtgatccgtctcatcgcggagaacgccgcc
gccgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system