KEGG   Polymorphum gilvum: SL003B_0752Help
Entry
SL003B_0752       CDS       T01458                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pgv  Polymorphum gilvum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SL003B_0752
   00051 Fructose and mannose metabolism
    SL003B_0752
Enzymes [BR:pgv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SL003B_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796074..797390
Genome map
AA seq 438 aa AA seqDB search
MATGFFDGLEPVRFVGADAREPYGYRFYDKDRVVLGKRLEDHLRLAVCYWHSFCWPGTDP
FGGETFQRAWMAAGDPMAQARLKADVAFEMFDLLGLPFFTFHDRDIAPEGATLAESNANV
NAIADVFEGKMADSGTRLLWGTANLFSNRRYMAGAATNPDPEVFAYAAAQVKTALDVTHR
LGGANYVLWGGREGYETLLNTDLKRELDQLGRFLALVVEYKHRIGFTGTILIEPKPQEPT
KHQYDFDVATVYGFLKAYGLEAEVKVNIEQGHAILAGHSFEHELALAHALGIFGSVDMNR
NDYQSGWDTDQFAMNVPELALAYREILKGGGFTTGGTNFDAKLRRQSLDAVDLIQAHVGS
ADAIARGLLAAAAMIEDGRLQATADARYAGWDRPENAAILSGERSLEDLAERVSRDRLEP
QPVSGRQEYLESLVNLFV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtggccactggatttttcgacggactggagccggtccgcttcgtcggcgccgatgcccgc
gagccctacggctatcgcttctacgacaaggacagggtggtgctcggcaagcgcttggag
gaccatctgcggctggccgtgtgctattggcattcgttctgctggccgggcaccgacccg
ttcggcggcgagacgttccagcgcgcctggatggcggcgggcgacccgatggcgcaggcg
cggctgaaggcggacgtcgccttcgagatgttcgacctgctcggcctgccgttcttcacc
ttccacgaccgcgacatcgcgccggagggcgcgacgctggcggagagcaacgccaacgtc
aacgccatcgccgatgtgttcgagggcaagatggccgacagcgggacgaggctgctgtgg
ggcacggcgaacctgttctccaaccgccgctacatggccggggcggcgaccaacccggac
ccggaggtgttcgcctacgcggccgcacaggtgaagaccgcgctcgacgtcacccatcgc
ctcggcggcgccaactacgtgctgtggggcgggcgcgagggctacgagacgctgctcaac
acggacctgaagcgcgagctggaccagctcggacggttcctcgccctggtggtcgagtac
aagcaccggatcggttttacgggaacgatcctgatcgagccgaagccgcaggagccgacc
aagcaccagtacgacttcgacgtcgccacggtctacggcttcctgaaggcctacgggctg
gaggccgaggtcaaggtcaacatcgagcagggccatgcgatcctggccggccattcgttc
gagcacgagctggcgctcgcccatgcgctcggcatcttcggttcggtcgacatgaaccgc
aacgactatcagtcgggctgggacaccgaccagttcgccatgaacgtgccggaactggcg
ctggcctatcgcgagatcctcaagggcggcggcttcacgaccggcggcaccaacttcgac
gccaagctgaggcgccagtcgctcgatgcggtcgatctgatccaggcccatgtcggttcg
gccgacgcgatcgcgcgcgggctgttggcggcggcggcgatgatcgaggacgggcggctg
caggcgaccgccgacgcccgctatgccggctgggacaggccggagaacgcggcgatcctt
tcgggcgagcggtcgctggaggatctggcggagcgggtcagccgcgaccgcctggagccg
cagccggtgtcgggacggcaggagtacctggaaagtctggtcaacctgttcgtgtga

DBGET integrated database retrieval system