KEGG   Polymorphum gilvum: SL003B_0856Help
Entry
SL003B_0856       CDS       T01458                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pgv  Polymorphum gilvum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SL003B_0856
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SL003B_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921170..922108
Genome map
AA seq 312 aa AA seqDB search
MSLIDLPENPVPPGAVCGYVDTPDGASIRYARWPAAGGTIRGTVTLLHGRAEFIEKYFEV
VADLRKRGFAVVAFDWRGQGGSNRQLRNPVRGHIRDFSRYRIDLETVIDSVSLADCPGPH
FALAHSTGGAVLLSAAERLRTQIHRAVLCAPLIGLRDFGPKERLIYRVAAVLTWLGFGRA
FIPTGNGVVTTTFEANKLTSDRVRFERMNAVLAAAPHLGVGSPTNGWLYAAARALRRFRH
PDFGPSVRLPMLIVAAGNDRIVSTRAAEDLATRTKAAGYVEIPGAQHELMMEADVYRDQF
WAAFDAFIPGQD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcgatcttcccgaaaaccccgtgccgcccggagcggtctgcggttatgtc
gacacgccggacggcgcctccattcgctatgcgcgctggcccgcggccggcgggacgatc
cggggcacggtcaccctgctgcacgggcgcgccgagttcatcgagaagtacttcgaggtc
gtggccgacctccggaagcgtggctttgccgtcgtcgccttcgactggcgcggccagggc
ggctcgaaccgccagttgcgcaacccggtccgcggccacatccgcgacttttcccgctac
cggatcgacctcgaaaccgtcatcgactccgtttcgcttgccgattgtccgggaccgcat
ttcgcgctcgcccattcgaccggcggcgccgtgctgctgtcggcggccgaacgcctgcgt
acgcagatccaccgggcggtgctctgcgcgccgctgatcggcctgcgcgacttcggcccg
aaggaacgcctgatctatcgcgtcgccgcggtgttgacctggctcggtttcgggcgcgcc
ttcatccccaccggcaatggcgtggtgaccacgaccttcgaggcgaacaagctgaccagc
gaccgcgtccgcttcgagcgtatgaacgcggtgctggccgcggctccgcatctcggcgtc
gggtcgccgaccaacggctggctctacgccgcggcccgcgccctgcgccggttccgccat
ccggatttcggccccagcgtgcgcctgccgatgctcatcgtcgcggcgggtaacgaccgg
atcgtctcgacccgcgcggccgaggatctggccacgcggaccaaggcggccggctatgtc
gagatccccggcgcacagcatgagttgatgatggaagcggacgtctaccgtgaccagttc
tgggcagccttcgacgccttcattcccgggcaggactga

DBGET integrated database retrieval system