KEGG   Polymorphum gilvum: SL003B_0951Help
Entry
SL003B_0951       CDS       T01458                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pgv  Polymorphum gilvum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SL003B_0951
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SL003B_0951
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SL003B_0951
Two-component system [BR:pgv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SL003B_0951
Bacterial motility proteins [BR:pgv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SL003B_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1016732..1017886
Genome map
AA seq 384 aa AA seqDB search
MVVDDAVVIRGLLGRWLDADPALAVVASHRNGKLAVDDILRSDPDVVVLDIEMPEMDGLT
ALPLMLAKKRDLVVVMASTLTRRNAEISLKALSLGAADYVPKPETTSEVTTSVDFRRELI
DKVKALGERARRLRGRGRVMRAETNAGRTASLAPVGALAARAAPSAMTARAAAPEPAAKG
ALKLRPYSSARPRILAIGSSTGGPQALQQVMRDIGTSIGEIPVVVTQHMPPTFTAILAEH
LGKAALRPSKEAETGDTLMPGHIYVAPGGKHMILEKDAGAVKVRLTDDPPVNFCKPAVDP
LFDSVAKVYGSATLGLILTGMGHDGANGVKTIAAGGGSVITQDEASSVVWGMPGAAANTG
MCSDVLPLAEIGPKIVRVLKGMVR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcgatgacgcggtagtcattcgcggattgctcggccggtggctggacgccgat
cccgccctcgccgtggtggcctcgcaccgaaacggcaagctggcggtcgacgacatcctg
cgcagcgatccggacgtggtcgtcctcgacatcgagatgccggagatggacggcctgacg
gcgctgccgctgatgctcgccaagaagcgcgacctggtcgtcgtgatggcgtcgaccctg
acccgtcgcaacgccgagatcagcctcaaggcgctgtcgctgggcgccgccgactatgtc
cccaaaccggaaaccacttcggaagtgaccacatcggtcgacttccggcgcgaactgatc
gacaaggtcaaggccctcggcgagcgcgcccgcaggctgcgcggtcgtggtcgcgtgatg
cgggccgagacgaacgccggccgcacggcctccctggcgcccgtcggcgcgctcgcggcc
cgcgccgcgccatccgcgatgaccgcccgcgccgcagcgccggaaccggcggccaagggc
gcgctcaagctgcggccctattcctcggcgcggccgcggatcctggcgatcggcagttcg
accggcggtccgcaggcgttgcagcaggtcatgcgcgacatcggcacatcgatcggcgag
atcccggtggtcgtgactcagcacatgccgccgacgttcacagcgatcctggccgagcat
ctcggcaaggcggcgctacgcccgtccaaggaagcggagaccggcgacaccctcatgccc
ggacacatctacgtcgcgccgggcggcaagcacatgatcctggagaaggatgccggagcg
gtgaaggtgcgtctgaccgacgacccgcccgtcaacttctgcaagccggccgtcgacccg
ttgttcgacagcgtggccaaggtctacgggtcggcgaccctcggcctgatcctgaccggc
atgggccatgacggagccaacggcgtcaagacgatcgccgccggcggcggcagcgtcatc
acccaggacgaagcctcgagcgtcgtgtggggcatgccgggcgcggccgccaacacgggc
atgtgcagcgacgtgctgccgctcgcggaaatcggacccaagatcgtccgcgttttgaaa
gggatggtccgatga

DBGET integrated database retrieval system