KEGG   Polymorphum gilvum: SL003B_1038Help
Entry
SL003B_1038       CDS       T01458                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pgv  Polymorphum gilvum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_1038
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL003B_1038
  Amino acid metabolism
   00310 Lysine degradation
    SL003B_1038
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SL003B_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1110440..1111780
Genome map
AA seq 446 aa AA seqDB search
MEVLMPQLGETVTEGTISTWFKSEGDAVAAGDVLFEIETEKVAMEVQAIESGTLTRVLVQ
AGETVAVGTTVAMIGEQAALTGGNPGLADPAGSNPSSGNPGPGAMNGAAPAPEGFGPYSE
VRTPTERFGSRHMAGGLRISPLARRIAAQQGIDVAGLARDLAAAGRRKILRDDVLGYAER
QKQSPAAAAPRPATVEARPMPARASLPAGGDYDLVPLNRIRRRTAEHLARSWTDVPHVAQ
AVEVDFQAVDKARRRLNDAHAAAWGFRLTYLPFIARAVCLAIREFPRVNASIDGDALRVH
RRVNLGIAVDLDHDGLMVPVVHGAEDLNLAGLARAMKDRIDRARAGKLTADDLTGGTYSL
SNSGTFGTLFTAPIVNAPEVAILSTDGIRKRPVVIEGEDEDRIAIRPVGVLAQSFDHRAF
DGAYSAAFLHRVRTILESRDWMSETG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaagttctgatgccccagctgggggaaacggtcaccgaagggacgatcagcacctgg
ttcaagagcgagggcgatgccgtcgcggccggcgacgtgctgttcgagatcgagaccgag
aaggtcgccatggaggtgcaggcgatcgagtcgggcacgctgacccgggtgctggtgcag
gccggcgagaccgttgccgtcggcaccaccgtggcgatgatcggcgagcaggcagcgctg
accggcggcaatcccggcctcgccgatcccgccggcagcaatcccagcagcggcaatccg
ggtccgggggcgatgaacggtgcggccccggcgccggagggcttcggtccctacagcgag
gtgcgcacaccgaccgaacggttcgggtcgcggcacatggccggtggcctcaggatctcg
ccgctcgcccggcgcatcgccgcgcagcagggcatcgacgtcgccggcctggcgcgcgac
ctggctgcggcgggacgcaggaagatcctgcgcgacgatgtgctgggctatgccgagagg
cagaagcagagcccggccgccgccgcgccccggccggccacggtcgaagcccggccgatg
ccggcgcgcgcgtcgctgcccgccggcggcgactacgacctcgtgccgctcaaccggatc
cgcaggcggacggccgagcatctggcccgttcctggacggacgtgccgcatgtcgcgcag
gcggtcgaggtcgacttccaggccgtcgacaaggcgcggcggcggctgaacgacgcgcac
gcggccgcctggggcttccggctgacctacctgccgttcatcgcccgtgccgtatgcctg
gcgatccgcgagtttccgcgtgtcaacgcttcgatcgacggggatgcgctcagggtccac
cggcgagtcaacctcggcatcgccgtggacctcgaccacgacggcttgatggtgccggtc
gtgcatggggcggaagacctcaatcttgccggactggcgcgcgccatgaaggaccggatc
gaccgggcccgggccggcaagctgaccgctgacgatctgaccggcggcacctattcgctg
tccaattccggtacgttcggcaccctgttcaccgcgccgatcgtcaacgcgccggaagtg
gcgatcctgtctaccgacggcatccgcaagcggccggtcgtcatcgagggcgaggacgag
gaccgcatcgcgatccgcccggtcggcgtgctggcgcagagcttcgatcacagggccttc
gacggcgcctattcggccgccttcctgcaccgggtaaggacgatcctcgaaagccgcgac
tggatgtcggaaacgggatga

DBGET integrated database retrieval system