KEGG   Polymorphum gilvum: SL003B_1038Help
Entry
SL003B_1038       CDS       T01458                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00020  Citrate cycle (TCA cycle)
pgv00310  Lysine degradation
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
Module
pgv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL003B_1038
  Amino acid metabolism
   00310 Lysine degradation
    SL003B_1038
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SL003B_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 Rop-like
Motif
Other DBs
NCBI-ProteinID: ADZ69467
UniProt: F2IYM0
Position
1110440..1111780
Genome map
AA seq 446 aa AA seqDB search
MEVLMPQLGETVTEGTISTWFKSEGDAVAAGDVLFEIETEKVAMEVQAIESGTLTRVLVQ
AGETVAVGTTVAMIGEQAALTGGNPGLADPAGSNPSSGNPGPGAMNGAAPAPEGFGPYSE
VRTPTERFGSRHMAGGLRISPLARRIAAQQGIDVAGLARDLAAAGRRKILRDDVLGYAER
QKQSPAAAAPRPATVEARPMPARASLPAGGDYDLVPLNRIRRRTAEHLARSWTDVPHVAQ
AVEVDFQAVDKARRRLNDAHAAAWGFRLTYLPFIARAVCLAIREFPRVNASIDGDALRVH
RRVNLGIAVDLDHDGLMVPVVHGAEDLNLAGLARAMKDRIDRARAGKLTADDLTGGTYSL
SNSGTFGTLFTAPIVNAPEVAILSTDGIRKRPVVIEGEDEDRIAIRPVGVLAQSFDHRAF
DGAYSAAFLHRVRTILESRDWMSETG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaagttctgatgccccagctgggggaaacggtcaccgaagggacgatcagcacctgg
ttcaagagcgagggcgatgccgtcgcggccggcgacgtgctgttcgagatcgagaccgag
aaggtcgccatggaggtgcaggcgatcgagtcgggcacgctgacccgggtgctggtgcag
gccggcgagaccgttgccgtcggcaccaccgtggcgatgatcggcgagcaggcagcgctg
accggcggcaatcccggcctcgccgatcccgccggcagcaatcccagcagcggcaatccg
ggtccgggggcgatgaacggtgcggccccggcgccggagggcttcggtccctacagcgag
gtgcgcacaccgaccgaacggttcgggtcgcggcacatggccggtggcctcaggatctcg
ccgctcgcccggcgcatcgccgcgcagcagggcatcgacgtcgccggcctggcgcgcgac
ctggctgcggcgggacgcaggaagatcctgcgcgacgatgtgctgggctatgccgagagg
cagaagcagagcccggccgccgccgcgccccggccggccacggtcgaagcccggccgatg
ccggcgcgcgcgtcgctgcccgccggcggcgactacgacctcgtgccgctcaaccggatc
cgcaggcggacggccgagcatctggcccgttcctggacggacgtgccgcatgtcgcgcag
gcggtcgaggtcgacttccaggccgtcgacaaggcgcggcggcggctgaacgacgcgcac
gcggccgcctggggcttccggctgacctacctgccgttcatcgcccgtgccgtatgcctg
gcgatccgcgagtttccgcgtgtcaacgcttcgatcgacggggatgcgctcagggtccac
cggcgagtcaacctcggcatcgccgtggacctcgaccacgacggcttgatggtgccggtc
gtgcatggggcggaagacctcaatcttgccggactggcgcgcgccatgaaggaccggatc
gaccgggcccgggccggcaagctgaccgctgacgatctgaccggcggcacctattcgctg
tccaattccggtacgttcggcaccctgttcaccgcgccgatcgtcaacgcgccggaagtg
gcgatcctgtctaccgacggcatccgcaagcggccggtcgtcatcgagggcgaggacgag
gaccgcatcgcgatccgcccggtcggcgtgctggcgcagagcttcgatcacagggccttc
gacggcgcctattcggccgccttcctgcaccgggtaaggacgatcctcgaaagccgcgac
tggatgtcggaaacgggatga

DBGET integrated database retrieval system