KEGG   Polymorphum gilvum: SL003B_1065Help
Entry
SL003B_1065       CDS       T01458                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pgv  Polymorphum gilvum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pgv00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1141527..1143014
Genome map
AA seq 495 aa AA seqDB search
MTHILAIDQGTTSSRAILFDETMAIASIAQEEFPQHYPASGWVEHDPADLWSSTAGSCRA
AIERVGASGADIAAIGITNQRETTLVWDRATGQPIHRAIVWQDRRTAGLCRDLREAGHEA
TVSERTGLLLDPYFSGTKLKWILDSVEGARERAKRGELLFGTVDSFLIWKLTGGAVHATD
ATNAARTLLYDIRKGRWSRTMCELLDIPMAMLPEVRDCAAEFGRTRADLFGREIPILGVA
GDQQAATIGQACFSPGMMKSTYGTGCFALLNTGDTPVASKSRLLTTIAYQFDGKPTYALE
GSIFIAGAVVQWLRDGLKIIRAADETQALAESADPRQSLILVPAFTGLGAPYWSAESRGA
IFGLTRNSGPAEFARAALESVGFQTRDLLEAMLVDWPSGAGGGVLRVDGGMSASDWAMQF
LSDILGAPVDRPRVLETTALGAAWLAGMRAGVYPDQETFAGSWAVERRFEPRLAGDVRAR
KYDAWKAAVRATMSV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacccacatcctcgccatcgaccagggcaccacctccagccgcgccatcctgttcgac
gagacgatggcgatcgcatcgatcgcccaggaggaattcccccagcactatccggcgagc
ggctgggtcgagcacgatcccgccgacctttggtcgtctacggccggctcgtgccgcgcg
gcgatagagcgggtcggggcgagcggcgccgacatcgcggcgatcggcatcaccaaccag
cgcgagacgacgctggtgtgggaccgggcgaccggccagccgatccaccgggcgatcgtc
tggcaggaccggcgcacggcgggtctgtgccgggacttgcgcgaggccggccacgaggcg
acggtcagcgagcgcacggggctgctgctcgatccttatttctccggcaccaagctgaaa
tggatcctggacagcgtcgagggcgcgcgggagcgcgccaagcgcggcgaactcctgttc
ggcacggtcgacagcttcctgatctggaagctgaccggcggcgcggtgcatgcgaccgac
gccaccaacgcggcgcgcacgctgctctacgacatccgcaaggggcgctggagccggacc
atgtgcgagctgctcgacattcccatggcgatgctgccggaggtgcgcgattgtgccgcc
gagttcgggcgcacgcgcgccgacctgttcggccgagagatcccgatcctcggcgtcgcc
ggcgaccagcaggcggccaccatcggccaggcctgcttctcgcccgggatgatgaagtcg
acctacggcaccggctgctttgcgctgctcaacaccggcgacacgccggtggcctcgaag
agccggctgctgaccaccatcgcctaccagttcgacggcaagccgacctacgcgcttgaa
ggctcgatcttcatcgccggagccgtggtgcaatggctgcgcgacgggctgaagatcatc
cgtgcggcggacgagacccaggcgctggcggaaagcgccgacccaagacagtcgttgatc
ctggtgccggcctttaccggcctcggcgcgccctactggagcgcggagagccgcggggcc
atcttcgggttgacgcgcaattccggaccggcggaattcgcccgcgcggcgctggaaagc
gtcggcttccagacccgcgacctgctggaggccatgctggtcgactggccgtcgggcgcc
ggtggcggcgtgctgcgcgtcgacggcggcatgagcgccagcgactgggcgatgcagttc
ctgtccgacatcctcggcgcgccggtcgaccggccgcgagtgctggagacgaccgcgctg
ggcgcggcctggctcgccggcatgcgcgccggcgtctatccggaccaggagaccttcgcc
ggcagctgggcggtcgagcgacgcttcgagccgcgcctggcgggcgatgtcagggcgcgc
aaatacgacgcctggaaggcggccgttcgggcgacgatgagcgtctga

DBGET integrated database retrieval system