KEGG   Polymorphum gilvum: SL003B_1084Help
Entry
SL003B_1084       CDS       T01458                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide acyltransferase (E2) component and related enzymes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pgv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgv00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pgv00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgv00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1163620..1164717
Genome map
AA seq 365 aa AA seqDB search
MKTFMLPDLGEGLQDAEIVAWHVDEGARVVADQPLVSVETQKAVVEVPSPWSGTVTRLCA
APGDVVAVGAPLADFDLEDAGTDAGSVVGTLEAAAPAAASTAKQPPAPAAGVRAAPAVRR
LAAERGVDLAAVAGTGPGGAITTADVEAAAGGRPGGGYEPLRGVRRAMAQNMARAHAEIA
AATVTDEARLDRWPAGEDVTLRLVQAMAVACQVEPALNAWYDGARAARRLHAVVDLGIAT
NTDDGLFVPVLRDVGSRSADDLRAGLKAMKADIRARTIPPRELQGQTITLSNFGMIGGRH
AALVVLPPQVAILGAGRITEEPRVVDGSVRPCRVLPLSLTFDHRAVTGAEAARFLMAVVR
SLEKE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatgctgccagacttgggggaagggctgcaggacgccgagatcgtcgcc
tggcatgtcgatgaaggcgcgcgcgttgtcgccgaccagccgctggtctcggtcgagacg
cagaaggcggtggtcgaggtgccctcgccgtggtcgggcacggtgacgcgcctgtgcgcg
gcgccgggagatgtggtcgctgtcggcgcgccgctggccgacttcgacctcgaggacgcg
ggcaccgatgccggctccgtcgtcggcacgctcgaggcggccgcgccggcggctgcatca
accgcgaagcaaccgccggcgcccgccgccggcgtcagggccgcccctgcggtgcgccgt
ctggcggccgagcgcggcgtcgacctcgccgccgtcgccggcaccgggccgggcggcgcg
atcacgacggcggacgtggaggctgccgccggcggcaggccgggcggcggctacgagccg
ctgcgcggcgtgcgccgcgcgatggcgcagaacatggcgcgcgcccatgcggagatcgcg
gcggcgacggtcaccgacgaggcacgcctcgaccgctggccggccggcgaggacgtcacg
ctgcgcctggtgcaggcgatggcggtggcgtgtcaggtcgagccggcgctcaacgcctgg
tacgacggcgcgcgtgcggcgcgccgtctgcatgcggtggtcgacctcggcatcgccacc
aacaccgacgacggcctgttcgtgccggtgctgcgtgacgtcggcagccggtcggccgac
gatttgcgtgccgggctcaaggccatgaaggccgacatccgcgcccgcaccatcccgccg
cgcgagttgcaggggcagaccatcaccctgtcgaacttcggcatgatcggcggacgccac
gcggccctcgtcgtgctgccgccgcaggtggcgatcctgggcgccgggcgcatcaccgag
gagccgagggtggtcgacggctcggtgcggccgtgccgggtgctgcccctgtcgctgacc
ttcgatcaccgcgccgtcaccggggcggaagccgcccggttcctgatggcggtcgtgcgg
agcctggagaaagaatga

DBGET integrated database retrieval system