KEGG   Polymorphum gilvum: SL003B_1342Help
Entry
SL003B_1342       CDS       T01458                                 

Gene name
murE
Definition
UDP-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase-like protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pgv  Polymorphum gilvum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pgv00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pgv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441439..1442908
Genome map
AA seq 489 aa AA seqDB search
MHLDSLAADLGLPHPPPTLSVSGLTADSRQVRPGFLFAALQGTAVDGWRFVPRALEQGAV
AVLTDAQGAAALAGTMPDSVPVLVAQDARRALALMAARFYGRQPNTMVAVTGTSGKTSVA
HFVRQIFEHAGHASASLGTIGTVTSRGRAYGGLTTPDPVSLHAELARLADEGITHAALEA
SSHGLEQHRLDGVRLVAGAFTNLGRDHMDYHATEEDYLQAKLRLFRDLLPAGGSVVVDPG
ERCADRVLAVARERGLHIFTVGERGADLRLTGLRHSGFSQELTVETPRGDYKISLPLAGR
FQVSNALIAAGLAITAGEATGAVLRALEDLEGAPGRLELVGRKANGALVFVDYAHKPDAL
ENALAALRPFTCGRLFVVIGAGGDRDPGKRPLMGAAAARHADVVIVTDDNPRSEDPAAIR
KAVLAGAPDALEIGDRGAAIAEAVARLEAGDVLCVAGKGHETGQIVGDTVLPFSDHDAVR
AALDTGDKA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcatctagacagcctcgcggccgacctcggcctgccgcatccgccgcccaccctttcc
gtttccggcctgaccgctgacagccgacaggtccgccccggtttcctgttcgccgcgctg
cagggcaccgccgtcgacggctggcggttcgtgcccagggccctggaacagggcgcggtt
gccgtgctgaccgacgcgcagggtgctgctgcgcttgccggcacgatgccggacagcgtt
cccgtcctggttgcccaggacgcccgccgggcgctggcgctgatggcggcgcgcttctac
ggccgccaaccgaacacgatggtcgcggtcaccggcaccagcggcaagacctccgtcgcc
catttcgttcgccagatcttcgagcatgccggccacgcctcggccagcctcggcaccatc
ggtacggtgacatcgagggggcgcgcctatggtgggctgaccacgcccgacccggtgtcg
ctgcacgccgaactggcccgcctggccgacgagggcattacccacgccgcgctggaggcg
tcgagccatgggctcgagcaacacaggctcgacggcgtgcggcttgtcgccggcgccttc
accaacctcggccgcgaccacatggattatcacgccaccgaagaagactacctgcaggcc
aagctgcggttgttccgcgacctgctgcctgccggcggaagcgtcgtcgtcgatccgggc
gagcgctgcgccgaccgggtgctggcggtggcccgcgagcgcggcctgcacatcttcacg
gtcggcgaacgcggcgcggacctgcgcctgaccggcctgcgccattccggcttcagccag
gaactgaccgtcgagacgccgcgcggcgactacaagatttcgctgccccttgccggtcgc
ttccaggtttccaacgcgctgatcgccgccggcctcgcgatcaccgccggcgaggcgacc
ggcgccgtgctgcgcgcgctggaggatctggaaggcgcgcccggccggctggaactggtc
gggcgcaaggccaacggcgcgctcgtcttcgtcgactacgcccacaagccggacgcgctg
gaaaacgcgctcgccgcgctgcggccgttcacctgcggccggcttttcgtcgtcatcggc
gccggcggcgaccgggatcccggcaagcgtccgctgatgggagccgccgccgcccgccat
gccgacgtggtcatcgtcaccgacgacaacccgcgcagcgaggatcccgccgcgatccgc
aaggcggtgctggccggtgcgccggacgcgctcgagatcggcgaccggggcgctgcgatc
gccgaggcggtagctcggctcgaggcgggcgacgtgctgtgcgttgccggcaagggccat
gaaacgggccaaatcgtcggcgacacggtgcttcccttttccgatcacgacgccgtgcgc
gccgccctcgatacaggagacaaggcatga

DBGET integrated database retrieval system