KEGG   Polymorphum gilvum: SL003B_1377Help
Entry
SL003B_1377       CDS       T01458                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pgv  Polymorphum gilvum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SL003B_1377
   00670 One carbon pool by folate
    SL003B_1377
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SL003B_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1485638..1486123
Genome map
AA seq 161 aa AA seqDB search
MIGADNDMPWHLPSDLRHFKTITLGKPVVMGRKTFESLGRPLPGRPNIVISRQPAYAPEG
VEVAGSLADALARAADLAADLGADEIVVMGGGQIYAEAMALADRLEITEVRARPEGDTRF
PAIDRDVWQETARVEGVRGEKDSACFCHVTWRRKDIPAPAQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggggcggacaacgacatgccctggcacctgccgtcggacctcaggcacttcaag
acgatcacgcttggaaagccggtggtgatgggccgcaagacgttcgaatcgctcggccgg
ccgctgccgggacgcccgaatatcgtcatctcgcgccagcccgcctatgcgcccgagggc
gtcgaggtggctggctcgcttgcggacgcgctggcgcgggcggcggacctggccgcagat
ctcggcgccgacgagatcgtcgtcatgggcggcgggcagatctatgccgaggcgatggca
ctcgccgaccggctggagatcaccgaggtgcgcgcgcggccggagggcgacacgcgcttt
ccggccatcgaccgggacgtgtggcaggagacggcgcgggtggagggcgtgcgcggcgag
aaggacagcgcctgcttctgccacgtcacctggcggcggaaggatatccccgcgccggcg
caatga

DBGET integrated database retrieval system