KEGG   Polymorphum gilvum: SL003B_1579Help
Entry
SL003B_1579       CDS       T01458                                 

Gene name
speB-4
Definition
Agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
pgv  Polymorphum gilvum
Brite
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     SL003B_1579 (speB-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693697..1694698)
Genome map
AA seq 333 aa AA seqDB search
MLGAERGLKMTGDDFSFEPVSGFDLPRFAGIPTFMRLPHVPLTDPRAAQVDIGLIGVPWD
GGTTNRPGARHGPRQLRDASTMIRFVHPHTGISPFRLVRCADLGDAPVNPADVQDALARI
TGFYDAVVDRGIMPLTAGGDHLVSLPILRALARSGPLGMIHFDAHTDLFDGYFGGFRYTH
GTPFRRAIEEDLLDPERVVQIGIRGTMYDGEDIEWGQAQGVRIVMIEELMERGLDDVMAE
ARERVGQEPTYVSFDIDGIDPAYAPGTGTPEIGGFTTFQAQRMVRKLNGLNLVGADLVEI
SPPFDPSGGTAWVGASMMFELLCVLATARDEIG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtgcagaacgggggctgaaaatgacgggtgacgacttttcgttcgagccggtg
tccggcttcgacctgccgcgcttcgccggcattccgaccttcatgcgcctgccgcatgtc
ccgctgaccgacccgcgcgcggcgcaggtcgacatcggcctcatcggcgtgccctgggac
ggcggcaccaccaaccgccccggcgcccgccacggcccgcgccagttgcgcgacgcctcg
accatgattcgattcgtccatccgcacaccggcatcagcccgttccggctggtccgctgc
gccgacctcggcgacgcgccggtcaatccggccgacgtgcaggatgcgctcgcccgcatc
accggcttctacgacgcggtcgtcgaccggggcatcatgccgctcaccgccggcggcgac
catctcgtctcgctgccgatcctgcgcgccctcgcccgctccggcccgctcggcatgatc
cacttcgatgcccataccgacctgttcgacggctatttcggcggcttccgctacacccac
ggcaccccgttccgccgtgccatcgaggaagacctgctcgacccggagcgcgtcgtccag
atcggcatccgcggcaccatgtacgacggcgaggacatcgagtggggccaggcccagggc
gtgcgcatcgtcatgatcgaggaactgatggagcgcggcctcgacgacgtcatggccgag
gcacgcgagcgcgtcggccaggagccgacctatgtcagcttcgacatcgacggcatcgac
cccgcctatgcgccgggcaccggcacgccggagatcggcggcttcaccactttccaggcc
cagcgcatggtgcgcaagctgaacggcctcaacctggtcggcgccgatctggtcgagatc
tctccgcccttcgacccctccggcggcaccgcctgggtcggagcctcgatgatgttcgaa
ctgctctgcgtcctcgccaccgcccgcgacgaaatcggctag

DBGET integrated database retrieval system