KEGG   Polymorphum gilvum: SL003B_1640Help
Entry
SL003B_1640       CDS       T01458                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pgv  Polymorphum gilvum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750523..1751158)
Genome map
AA seq 211 aa AA seqDB search
MDAILKPVGNKAVRKAPHEVARPSREEAEAAVRTLLAWIGDDPEREGLLDTPKRVVKAYT
EVLGGYFEDPEEHLQRTFEDVGGYDELIMVRDIPFHSFCEHHMLPFIGTAHIAYYPSGGV
VGLSKLARVVDIYARRLQTQEHLTAQIVSAIDSHLAPRGLAVMLEAEHQCMTMRGVQKQG
VSTITTQFTGVFQDDPSEQVRFITLVRGGSR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcttgaagccggtcgggaacaaggccgtacgcaaggccccgcacgaggtc
gcgcggccgagtcgcgaggaagcggaagccgccgtgcgcacccttctggcctggatcggc
gacgatcccgagcgcgagggtctgctcgacacgcccaagcgcgtggtgaaggcttacacc
gaggtcctcggcggctatttcgaggatccggaggagcatctccagcgcaccttcgaggat
gtcggcggctatgatgaactcatcatggtgcgcgacattcccttccactccttctgcgaa
caccacatgttgccgttcatcggcaccgcccacattgcctattatccctccggcggtgtc
gtcggcctgtcgaagctcgcccgcgtcgtcgacatctacgctcgccgtctccagacccag
gagcacttgacggctcagatcgtgtcggccattgacagtcaccttgcaccgcgcggcctg
gccgtgatgctggaagccgaacaccagtgcatgaccatgcgtggggtccagaaacagggc
gtatcgacgatcacgacccagttcaccggcgtgttccaggacgaccccagcgaacaggtg
cgcttcataaccttggtacgcggcggcagcaggtag

DBGET integrated database retrieval system