KEGG   Polymorphum gilvum: SL003B_1908Help
Entry
SL003B_1908       CDS       T01458                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pgv  Polymorphum gilvum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SL003B_1908 (hemB)
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SL003B_1908 (hemB)
Exosome [BR:pgv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SL003B_1908 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2004306..2005343)
Genome map
AA seq 345 aa AA seqDB search
MRPPSRSPLVTPQTMDDLLGGRRMRRNRRADWSRRLVRETTLEVDDLIWPMFLVDGTGVR
QAVPSMPGVERLSVDEAVREAEYAASLSIPALALFPYTDPTLRDATGSEALNPQNLVCRA
CRAIKAAGLNIGLITDVALDPYTSHGHDGLMKGETILNDETVDQLCRQALNQVEAGADVI
APSDMMDGRVGAIRQSLDGEGHRDVQIMSYAAKYASAFYGPFRDAVGTSKTLVGDKRTYQ
MDPANTDEALREVELDIEEGADMIMVKPGMPYLDIVWRVKDAFRVPTYAYQVSGEYAMIS
AAAANGWLDGERAMLESLMAFKRAGADGVLTYFAPKVAELLKRGC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgccatcccgcagcccgctcgtcacgccgcaaaccatggacgacctgctcggc
gggcggcgcatgcgccgcaaccggcgcgccgactggtcgcggcgcctcgtgcgcgagacg
acgctcgaggtcgacgacctgatctggccgatgttcctggtcgacggcaccggcgtgcgc
caggcggttccgtcgatgccgggcgtcgagcgcctgtcggtcgacgaggccgtgcgcgag
gccgaatatgcggccagtctgtcgatcccggctctcgccctgtttccctacaccgatccg
acgctgcgcgacgccaccggcagcgaggcgctcaatccgcagaatctcgtctgccgcgcc
tgccgggcgatcaaggcggcggggctgaacatcggcctgatcacggacgtggcgctcgac
ccctataccagccacggccacgacgggctgatgaagggcgagacgattctcaacgacgag
acggtcgaccagttgtgccggcaggccctcaaccaggtcgaggctggcgccgacgtcatt
gcgccctccgatatgatggacggacgcgtcggagcgatccgccagagtctcgacggcgaa
ggccaccgcgacgtgcagatcatgtcctatgccgccaagtacgcctccgccttctacggc
ccgttccgcgacgcggtcggcaccagcaagacgctcgtcggcgacaagcgcacctaccag
atggacccggccaacaccgacgaggccctgcgcgaggtcgaactcgacatcgaggaaggc
gccgacatgatcatggtcaagcccggcatgccctatctcgacatcgtctggcgggtgaag
gacgccttccgagtaccaacctacgcctaccaggtctcgggcgaatacgcgatgatcagc
gcggcggcggccaacggctggctcgacggcgagcgggcaatgttggaaagcctgatggcc
ttcaagcgcgcgggcgccgatggcgtgctgacctatttcgccccgaaagtggcggaactg
ctgaagcgcggctgctga

DBGET integrated database retrieval system