KEGG   Polymorphum gilvum: SL003B_1910Help
Entry
SL003B_1910       CDS       T01458                                 

Definition
Enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pgv  Polymorphum gilvum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SL003B_1910
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SL003B_1910
   00650 Butanoate metabolism
    SL003B_1910
  Lipid metabolism
   00071 Fatty acid degradation
    SL003B_1910
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SL003B_1910
   00310 Lysine degradation
    SL003B_1910
   00360 Phenylalanine metabolism
    SL003B_1910
   00380 Tryptophan metabolism
    SL003B_1910
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL003B_1910
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SL003B_1910
   00281 Geraniol degradation
    SL003B_1910
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SL003B_1910
   00627 Aminobenzoate degradation
    SL003B_1910
   00930 Caprolactam degradation
    SL003B_1910
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SL003B_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2006768..2007817
Genome map
AA seq 349 aa AA seqDB search
MTDEVLFEIRGRAGFITLNRSAALNALTLAMVRAMAERLDAWARDDSIAHVVVRGAGGKA
FCAGGDIRRIYEMGKAGDPHQVDFFAEEYRLNAQIKAFSKPYVSLIDGIVMGGGVGISVH
GSHRLGTERLTFAMPETGIGFFPDVGGTYVLPRMPRASGIWCALTAGRMKQADALWSGVL
THAVHAADLDAIETALAEAADVDAALAPFAADPGPAPILDTAEEMEAAFSRDSLAGILAA
LQASGSDFAVATLKTLAARSPTSVAIAFEQMRRGRNLDFAGCMRLEFRIVNRILREHDFY
EGVRAVLIDKDNAPRWRPSSFDAVDSAALAAYFEEPACGDLVLAREGPP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaggtgcttttcgagattcggggccgagccggcttcatcaccctgaaccgg
tcggcggcgctcaacgcgctgacgctcgccatggtgcgggcgatggccgagcggctcgat
gcctgggcccgtgacgacagcatcgcccatgtcgtcgtgcgcggcgccggcgggaaggcc
ttctgcgccggcggcgacatccgcaggatctacgagatgggcaaggctggcgacccgcac
caggtcgacttcttcgccgaggaatatcgcctcaacgcgcagatcaaggcgttctccaag
ccctatgtctccctgatcgacggcatcgtcatgggcggcggcgtcggcatctcggtgcac
ggcagccaccgccttggcaccgagcggctgaccttcgccatgccggagaccggtatcggc
ttcttccccgacgtcggcggcacctacgtcctgccgcgcatgccgcgcgccagcggcatc
tggtgcgcgctgaccgccggacgcatgaagcaggccgacgcgctgtggtccggcgtgctg
acccatgcggtgcacgcggccgacctcgacgccatcgagacggcgctcgcggaggcggcg
gacgtcgacgcggcgctcgcgcccttcgccgcggatcccggcccggcgccgatcctcgac
accgcggaggagatggaggcggccttttcccgcgacagcctcgcgggcatcctcgctgcc
ctgcaggcctccggctccgatttcgccgtggcgaccctgaagaccttggctgcccgctcg
ccgaccagcgtcgccatcgccttcgagcagatgcggcgcggccggaatctcgatttcgcc
ggctgcatgaggcttgagttccggatcgtcaaccgcatcctcagggaacacgacttctac
gagggcgtccgcgcggtgctgattgacaaggacaatgctccccgctggcggccctcgtcc
ttcgacgcggtggacagcgcggcgctcgcggcgtatttcgaggagcccgcctgcggcgac
ctcgtccttgcccgagaaggcccgccatga

DBGET integrated database retrieval system