KEGG   Polymorphum gilvum: SL003B_1910Help
Entry
SL003B_1910       CDS       T01458                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00071  Fatty acid degradation
pgv00280  Valine, leucine and isoleucine degradation
pgv00281  Geraniol degradation
pgv00310  Lysine degradation
pgv00360  Phenylalanine metabolism
pgv00362  Benzoate degradation
pgv00380  Tryptophan metabolism
pgv00410  beta-Alanine metabolism
pgv00627  Aminobenzoate degradation
pgv00640  Propanoate metabolism
pgv00650  Butanoate metabolism
pgv00903  Limonene and pinene degradation
pgv00930  Caprolactam degradation
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01212  Fatty acid metabolism
Module
pgv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SL003B_1910
   00650 Butanoate metabolism
    SL003B_1910
  Lipid metabolism
   00071 Fatty acid degradation
    SL003B_1910
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SL003B_1910
   00310 Lysine degradation
    SL003B_1910
   00360 Phenylalanine metabolism
    SL003B_1910
   00380 Tryptophan metabolism
    SL003B_1910
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL003B_1910
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SL003B_1910
   00281 Geraniol degradation
    SL003B_1910
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SL003B_1910
   00627 Aminobenzoate degradation
    SL003B_1910
   00930 Caprolactam degradation
    SL003B_1910
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SL003B_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ADZ70336
UniProt: F2IWL1
Position
2006768..2007817
Genome map
AA seq 349 aa AA seqDB search
MTDEVLFEIRGRAGFITLNRSAALNALTLAMVRAMAERLDAWARDDSIAHVVVRGAGGKA
FCAGGDIRRIYEMGKAGDPHQVDFFAEEYRLNAQIKAFSKPYVSLIDGIVMGGGVGISVH
GSHRLGTERLTFAMPETGIGFFPDVGGTYVLPRMPRASGIWCALTAGRMKQADALWSGVL
THAVHAADLDAIETALAEAADVDAALAPFAADPGPAPILDTAEEMEAAFSRDSLAGILAA
LQASGSDFAVATLKTLAARSPTSVAIAFEQMRRGRNLDFAGCMRLEFRIVNRILREHDFY
EGVRAVLIDKDNAPRWRPSSFDAVDSAALAAYFEEPACGDLVLAREGPP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaggtgcttttcgagattcggggccgagccggcttcatcaccctgaaccgg
tcggcggcgctcaacgcgctgacgctcgccatggtgcgggcgatggccgagcggctcgat
gcctgggcccgtgacgacagcatcgcccatgtcgtcgtgcgcggcgccggcgggaaggcc
ttctgcgccggcggcgacatccgcaggatctacgagatgggcaaggctggcgacccgcac
caggtcgacttcttcgccgaggaatatcgcctcaacgcgcagatcaaggcgttctccaag
ccctatgtctccctgatcgacggcatcgtcatgggcggcggcgtcggcatctcggtgcac
ggcagccaccgccttggcaccgagcggctgaccttcgccatgccggagaccggtatcggc
ttcttccccgacgtcggcggcacctacgtcctgccgcgcatgccgcgcgccagcggcatc
tggtgcgcgctgaccgccggacgcatgaagcaggccgacgcgctgtggtccggcgtgctg
acccatgcggtgcacgcggccgacctcgacgccatcgagacggcgctcgcggaggcggcg
gacgtcgacgcggcgctcgcgcccttcgccgcggatcccggcccggcgccgatcctcgac
accgcggaggagatggaggcggccttttcccgcgacagcctcgcgggcatcctcgctgcc
ctgcaggcctccggctccgatttcgccgtggcgaccctgaagaccttggctgcccgctcg
ccgaccagcgtcgccatcgccttcgagcagatgcggcgcggccggaatctcgatttcgcc
ggctgcatgaggcttgagttccggatcgtcaaccgcatcctcagggaacacgacttctac
gagggcgtccgcgcggtgctgattgacaaggacaatgctccccgctggcggccctcgtcc
ttcgacgcggtggacagcgcggcgctcgcggcgtatttcgaggagcccgcctgcggcgac
ctcgtccttgcccgagaaggcccgccatga

DBGET integrated database retrieval system