KEGG   Polymorphum gilvum: SL003B_2037Help
Entry
SL003B_2037       CDS       T01458                                 

Definition
methyltransferase (Pcm-like) transmembrane protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pgv  Polymorphum gilvum
Brite
Enzymes [BR:pgv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SL003B_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2141051..2141713
Genome map
AA seq 220 aa AA seqDB search
MADYAQSRTRMVNTQLRTNDVTDHRILDAMESVPRELFVAASRRPIAYIDEDIAISDAAP
GRYLMKPHVFAKLIQLAAVRPEDVVLVVGAGSGYSAAVLAKLAGMVVAVEENPDLAAMAS
EILVEQGIENAAVIEGKLTDGCASEGPYDVIVFDGAIEVLPERLAGQLKRGGRMVAIEGR
GGAGIAKLYQDSGESIGARFAFNASAHVLPGFEKAREFQF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgactatgcgcaatcccgcacgcggatggtgaacacccagctgaggacgaacgac
gtcaccgaccatcggatcctcgatgcgatggaaagcgttccgcgcgagctgtttgtcgcc
gcctccagacggccgatcgcctatatcgacgaggacatcgccatttccgacgcggcaccc
ggccgctacctgatgaagccgcatgtcttcgccaagctgatccagctcgccgcggtcagg
cccgaggacgttgtcctggtcgtcggcgccggctccggctacagcgccgccgtcctggcc
aagctggccggcatggtcgtggccgtggaggagaatccggatcttgccgcgatggcgagc
gagatcctggtggagcagggcatcgagaacgcggcggtgatcgagggcaagctgaccgac
ggctgcgccagcgaagggccctacgacgtcatcgtcttcgatggcgccatcgaggtgctg
cccgagcggctcgccggccagttgaagcgcggcggtcgcatggtcgcgatcgaggggcgc
ggcggcgccggcatcgcgaagctctatcaggattcgggcgaatcgatcggcgcgcgcttc
gccttcaatgcgtccgcgcatgtccttccgggctttgaaaaggcccgggaattccagttc
tga

DBGET integrated database retrieval system